Accugel 19:1 40%

Accugel 19:1 40%

To Order Now: info@anbioq.org

1L AccuGel 19:1 (40%)
NAT1182 1L
EUR 140
450ML AccuGel 29:1 (40%)
NAT1188 450ML
EUR 109
1L AccuGel 29:1 (40%)
NAT1190 1L
EUR 140
450ML AccuGel 19:1 (30%)
NAT1176 450ML
EUR 105
1L AccuGel 19:1 (30%)
NAT1178 1L
EUR 138
FUNNEL, 40 MM, PP
6120P-40 24/pk
EUR 44
Description: Reusable Plastics; Reusable Funnels
Acrylamide : bis 40%, 19:1 Solution
A0420-050 495ml
EUR 151
450ML AccuGel 29:1 (30%)
NAT1184 450ML
EUR 105
1L AccuGel 29:1 (30%)
NAT1186 1L
EUR 138
Nogo-66 (1-40)
B5247-1 1 mg
EUR 609
DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm
GFL-40 1 mL
EUR 1053
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Hu-48T 48T
EUR 479
  • Should the Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Hu-96T 96T
EUR 621
  • Should the Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-48T 48T
EUR 489
  • Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-96T 96T
EUR 635
  • Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Ra-48T 48T
EUR 508
  • Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Ra-96T 96T
EUR 661
  • Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Hu-48Tests 48 Tests
EUR 478
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Hu-96Tests 96 Tests
EUR 662
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Mu-48Tests 48 Tests
EUR 489
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Mu-96Tests 96 Tests
EUR 677
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Ra-48Tests 48 Tests
EUR 511
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Ra-96Tests 96 Tests
EUR 709
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Hu-48Tests 48 Tests
EUR 500
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Hu-96Tests 96 Tests
EUR 692
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Mu-48Tests 48 Tests
EUR 511
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Mu-96Tests 96 Tests
EUR 709
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Ra-48Tests 48 Tests
EUR 534
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Ra-96Tests 96 Tests
EUR 742
DiagNano Gold Nanoparticle Passive Conjugation Kit, 40 nm
GPK-40 1 kit
EUR 715
Acryl/Bis solution (19: 1), 40% (w/v)
A0006 500ml
EUR 77.84
  • Product category: Electrophoresis Related/Acry/Bis-Acrylamide/Acryl/Bis
Amyloid Beta-Peptide (1-40) (human)
A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.
Cytokeratin 19 (40 kD); Clone BA 17
A00094 6 ml
EUR 220
Cytokeratin 19 (40 kD); Clone BA 17
A00094.0025 25 ml
EUR 514
Cytokeratin 19 (40 kD); Clone BA 17
A20094 2 ml
EUR 136
CORNING® REUSABLE PHENOLIC GPI 40-400 THREADED SCREW CAP WITH RUBBER LINER
9999-40 72/pk
EUR 140
Description: General Apparatus; Stoppers
ExoDNAPS? Circulating and Exosome-associated DNA Extraction Kit (Human Plasma/Serum, 40 reactions)
K1230-40
EUR 1061
ExoDNAUC? Circulating and Exosome-associated DNA Extraction Kit (Urine/Cell Media, 40 reactions)
K1231-40
EUR 1061
FGF-19 Fibroblast Growth Factor-19 Human Recombinant Protein
PROTO95750-1 Regular: 25ug
EUR 317
Description: FGF19 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 195 amino acids and having a molecular mass of 21.8 kDa.;The FGF-19 is purified by proprietary chromatographic techniques.
40 bp random library with flanking sequence; DNA aptamer
DAL-N-40 100 ug
EUR 408
DiagNano Gold Nanoparticle Medium Covalent Conjugation Kit, 40 nm
GCK-M-40 1 kit
EUR 757
DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm, Cellular Uptake
GFL-40-CU 1mL
EUR 1365
TESTO (Testosterone) ELISA test
19 96T/Box Ask for price
  • Area of application: Hormone testing
Description: ELISA based test for quantitative detection of O (osterone)
Anti-Claudin-19 Antibody
A08096-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Claudin-19 Antibody (CLDN19) detection. Tested with WB in Human, Rat.
Anti-TCF-19 Antibody
A10508-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TCF-19 Antibody (TCF19) detection. Tested with WB in Human, Mouse, Rat.
Anti-MMP-19 Antibody
A05171-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for MMP-19 Antibody (MMP19) detection.tested for WB in Human, Mouse.
Polyclonal KRT19 / CK19 / Cytokeratin 19 Antibody (aa21-40)
APR17075G 0.05mg
EUR 484
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human KRT19 / CK19 / Cytokeratin 19 (aa21-40). This antibody is tested and proven to work in the following applications:
DiagNano Gold Nanorods, diameter 40 nm, absorption max 550 nm
BR-40-550 25 mL
EUR 720
DiagNano Gold Nanorods, diameter 40 nm, absorption max 600 nm
BR-40-600 25 mL
EUR 720
DiagNano Gold Nanorods, diameter 40 nm, absorption max 650 nm
BR-40-650 25 mL
EUR 720
DiagNano Gold Nanorods, diameter 40 nm, absorption max 750 nm
BR-40-750 25 mL
EUR 720
DiagNano Gold Nanorods, diameter 40 nm, absorption max 780 nm
BR-40-780 25 mL
EUR 720
DiagNano Gold Nanorods, diameter 40 nm, absorption max 808 nm
BR-40-808 25 mL
EUR 720
DiagNano Gold Nanorods, diameter 40 nm, absorption max 850 nm
BR-40-850 25 mL
EUR 720
Anti-Cytokeratin 19
DB-103-1 1 ml
EUR 450
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 550 nm
OR-40-550 1 mL
EUR 1022
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 600 nm
OR-40-600 1 mL
EUR 1022
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 650 nm
OR-40-650 1 mL
EUR 1022
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 700 nm
OR-40-700 1 mL
EUR 1022
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 750 nm
OR-40-750 1 mL
EUR 1022
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFA-40-550 1 mL
EUR 1022
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFA-40-650 1 mL
EUR 1022
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFA-40-700 1 mL
EUR 1022
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFA-40-750 1 mL
EUR 1022
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFB-40-550 1 mL
EUR 1022
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFB-40-600 1 mL
EUR 1022
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFB-40-650 1 mL
EUR 1022
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFB-40-750 1 mL
EUR 1022
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFC-40-550 1 mL
EUR 1022
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFC-40-600 1 mL
EUR 1022
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFC-40-650 1 mL
EUR 1022
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFC-40-700 1 mL
EUR 1022
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFC-40-750 1 mL
EUR 1022
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFM-40-550 1 mL
EUR 1022
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFM-40-650 1 mL
EUR 1022
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFM-40-700 1 mL
EUR 1022
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFM-40-750 1 mL
EUR 1022
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFN-40-550 1 mL
EUR 1022
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFN-40-600 1 mL
EUR 1022
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFN-40-650 1 mL
EUR 1022
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFN-40-700 1 mL
EUR 1022
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFN-40-750 1 mL
EUR 1022
Abeta 40 (beta amyloid 1-40)
RA25009 100 ul
EUR 383
FGF-19, human recombinant protein
P1050-.1 100 µg
EUR 738
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis.
FGF-19, human recombinant protein
P1050-1 1 mg
EUR 4156
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis.
Recombinant Human IL-19 Protein
PROTQ9UHD0-1 10ug
EUR 317
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant human IL-19 is a 17.9 kDa protein containing 153 amino acid residues. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RCG-40-550 1 mL
EUR 1022
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RCG-40-600 1 mL
EUR 1022
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RCG-40-650 1 mL
EUR 1022
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RCG-40-700 1 mL
EUR 1022
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RCG-40-750 1 mL
EUR 1022
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RCN-40-550 1 mL
EUR 1022
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RCN-40-600 1 mL
EUR 1022
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RCN-40-650 1 mL
EUR 1022
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RCN-40-700 1 mL
EUR 1022
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RCS-40-550 1 mL
EUR 1022
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RCS-40-600 1 mL
EUR 1022
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RCS-40-700 1 mL
EUR 1022
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RCS-40-750 1 mL
EUR 1022
DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFL-40-550 1 mL
EUR 1022
DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFL-40-600 1 mL
EUR 1022
DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFL-40-650 1 mL
EUR 1022
DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFL-40-700 1 mL
EUR 1022
DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFL-40-750 1 mL
EUR 1022
DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RGS-40-550 1 mL
EUR 1022
DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RGS-40-650 1 mL
EUR 1022
DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RGS-40-700 1 mL
EUR 1022
DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RGS-40-750 1 mL
EUR 1022
Human Cyclophilin-40 (PPID) AssayMax ELISA Kit
EC2050-1 96 Well Plate
EUR 417
DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RCA-40-550 1 mL
EUR 1022
DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RCA-40-600 1 mL
EUR 1022
DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RCA-40-650 1 mL
EUR 1022
DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RCA-40-700 1 mL
EUR 1022
DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RCA-40-750 1 mL
EUR 1022
DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 550 nm
RCK-40-550 1 kit
EUR 1043
DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 600 nm
RCK-40-600 1 kit
EUR 1043
DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 650 nm
RCK-40-650 1 kit
EUR 1043
DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 700 nm
RCK-40-700 1 kit
EUR 1043
DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 750 nm
RCK-40-750 1 kit
EUR 1043
[Ser25] Protein Kinase C (19-31)
A1033-1 1 mg
EUR 102
Description: Protein Kinase C (19-31), (C67H118N26O17), a peptide with the sequence H-ARG-PHE-ALA-ARG-LYS-GLY-SER-LEU-ARG-GLN-LYS-ASN-VAL-OH, MW= 1559.82.
Anti-Cytokeratin 19 Rabbit Monoclonal Antibody
M02101-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Cytokeratin 19 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse.
DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RHA-40-550 1 mL
EUR 1022
DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RHA-40-600 1 mL
EUR 1022
DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RHA-40-650 1 mL
EUR 1022
DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RHA-40-750 1 mL
EUR 1022
DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RHG-40-550 1 mL
EUR 1022
DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RHG-40-600 1 mL
EUR 1022
DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RHG-40-650 1 mL
EUR 1022
DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RHG-40-700 1 mL
EUR 1022
DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RHG-40-750 1 mL
EUR 1022
DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RHM-40-550 1 mL
EUR 1022
DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RHM-40-600 1 mL
EUR 1022
DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RHM-40-650 1 mL
EUR 1022
DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RHM-40-700 1 mL
EUR 1022
DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RHM-40-750 1 mL
EUR 1022
DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RRG-40-550 1 mL
EUR 1022
DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RRG-40-600 1 mL
EUR 1022
DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RRG-40-650 1 mL
EUR 1022
DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RRG-40-700 1 mL
EUR 1022
DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RRG-40-750 1 mL
EUR 1022
DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RMG-40-550 1 mL
EUR 1022
DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RMG-40-600 1 mL
EUR 1022
DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RMG-40-650 1 mL
EUR 1022
DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RMG-40-700 1 mL
EUR 1022
DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RMG-40-750 1 mL
EUR 1022
egg white lysozyme (19-36) [Gallus gallus]
A1065-1 1 mg
EUR 108
Description: Sequence: H2N-KVFGRCELAAAMKRHGLD-OHFormula of Egg white lysozyme (19-36) [Gallus gallus]:C86H144N28O23S2Hen egg white lysozyme has a molecular weight of about 14,600 and each molecule comprises 129 amino acid residues1.
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody
20-abx175368
  • EUR 398.00
  • EUR 133.00
  • EUR 1094.00
  • EUR 537.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody
20-abx175369
  • EUR 411.00
  • EUR 133.00
  • EUR 1135.00
  • EUR 551.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody
20-abx132222
  • EUR 425.00
  • EUR 133.00
  • EUR 1177.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Synthetic Amyloid Beta Peptide 1-40 (Ab1-40)
4-SPA864Hu02
  • EUR 350.88
  • EUR 197.00
  • EUR 1040.80
  • EUR 413.60
  • EUR 727.20
  • EUR 298.00
  • EUR 2452.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 4329.9Da
  • Isoelectric Point: 5.3
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli
beta-Amyloid(40-1)
5-00456 4 x 1mg Ask for price
β-Amyloid (1-40)
HY-P0265 5mg
EUR 587
MP (Mycoplasma Pneumoniae Antibody IgG) ELISA test
40 96T/Box Ask for price
  • Area of application: Respiratory tract testing
Description: ELISA based test for quantitative detection of MP (Mycoplasma Pneumoniae Antibody IgG)
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide
abx670346-1mg 1 mg
EUR 523
  • Shipped within 1 week.
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide
20-abx652283
  • EUR 314.00
  • EUR 203.00
  • EUR 773.00
  • EUR 342.00
  • EUR 258.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu11
  • EUR 221.86
  • EUR 162.00
  • EUR 556.96
  • EUR 252.32
  • EUR 404.64
  • EUR 211.00
  • EUR 1242.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation
OVA conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu21
  • EUR 431.52
  • EUR 218.00
  • EUR 1343.20
  • EUR 514.40
  • EUR 928.80
  • EUR 352.00
  • EUR 3208.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu23
  • EUR 341.02
  • EUR 194.00
  • EUR 1003.84
  • EUR 401.28
  • EUR 702.56
  • EUR 291.00
  • EUR 2359.60
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Hu31
  • EUR 246.05
  • EUR 169.00
  • EUR 647.68
  • EUR 282.56
  • EUR 465.12
  • EUR 227.00
  • EUR 1469.20
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P05067#PRO_0000000093
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Mu11
  • EUR 221.86
  • EUR 162.00
  • EUR 556.96
  • EUR 252.32
  • EUR 404.64
  • EUR 211.00
  • EUR 1242.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Mu21
  • EUR 221.86
  • EUR 162.00
  • EUR 556.96
  • EUR 252.32
  • EUR 404.64
  • EUR 211.00
  • EUR 1242.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Mu31
  • EUR 246.05
  • EUR 169.00
  • EUR 647.68
  • EUR 282.56
  • EUR 465.12
  • EUR 227.00
  • EUR 1469.20
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Ra11
  • EUR 221.86
  • EUR 162.00
  • EUR 556.96
  • EUR 252.32
  • EUR 404.64
  • EUR 211.00
  • EUR 1242.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Ra21
  • EUR 221.86
  • EUR 162.00
  • EUR 556.96
  • EUR 252.32
  • EUR 404.64
  • EUR 211.00
  • EUR 1242.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)
4-CPA864Ra31
  • EUR 246.05
  • EUR 169.00
  • EUR 647.68
  • EUR 282.56
  • EUR 465.12
  • EUR 227.00
  • EUR 1469.20
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation
Rat beta-40(Amyloid Beta 1-40) ELISA Kit
STJ150091 1 kit
EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Rat serum, plasma and other biological fluids
Human amyloid beta peptide 1-40,A?1-40 ELISA Kit
201-12-1231 96 tests
EUR 440
  • This amyloid beta peptide 1-40 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.
ELISA kit for Human A?1-40 (Amyloid Beta 1-40)
E-EL-H0542 1 plate of 96 wells
EUR 377
  • Gentaur's A?1-40 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human A?1-40. Standards or samples are added to the micro ELISA plate wells and combined wit
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Human A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Mouse A?1-40 (Amyloid Beta 1-40)
E-EL-M0067 1 plate of 96 wells
EUR 377
  • Gentaur's A?1-40 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Mouse A?1-40. Standards or samples are added to the micro ELISA plate wells and combined wit
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Mouse A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Monkey A?1-40 (Amyloid Beta 1-40)
E-EL-MK0477 1 plate of 96 wells
EUR 584
  • Gentaur's A?1-40 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Monkey A?1-40. Standards or samples are added to the micro ELISA plate wells and combined wi
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Monkey A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Rat A?1-40 (Amyloid Beta 1-40)
E-EL-R1401 1 plate of 96 wells
EUR 377
  • Gentaur's A?1-40 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Rat A?1-40. Standards or samples are added to the micro ELISA plate wells and combined with
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Rat A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant
Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
CSB-E08299h-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid (CSF). A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
1-CSB-E08299h
  • EUR 900.00
  • EUR 5476.00
  • EUR 2900.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
CSB-E08300m-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
1-CSB-E08300m
  • EUR 946.00
  • EUR 5782.00
  • EUR 3060.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
CSB-E08302r-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit
1-CSB-E08302r
  • EUR 967.00
  • EUR 5925.00
  • EUR 3134.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Mouse Insulin ELISA Kit, High Sensitivity, Quantitative, 96 tests
0030-40-1 1 kit
EUR 712
Beta 2 Microglobulin (B2M) Partially Pure (40-90%)
B2M17-N-1 1 mg
EUR 286
KRT19 Human, Cytokeratin 19 Human Recombinant Protein , His Tag
PROTP08727-1 Regular: 20ug
EUR 317
Description: KRT19 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 423 amino acids (1-400) and having a molecular mass of 46.5kDa.;KRT19 is fused to a 23 amino acid His-Tag at N-terminus and purified by proprietary chromatographic techniques.

Accugel 19:1 40%