Accugel 19:1 40%
To Order Now: info@anbioq.org
![]() |
|||
NAT1182 | National Diagnostics | 1L | EUR 140 |
![]() |
|||
NAT1188 | National Diagnostics | 450ML | EUR 109 |
![]() |
|||
NAT1190 | National Diagnostics | 1L | EUR 140 |
![]() |
|||
NAT1176 | National Diagnostics | 450ML | EUR 105 |
![]() |
|||
NAT1178 | National Diagnostics | 1L | EUR 138 |
![]() |
|||
6120P-40 | CORNING | 24/pk | EUR 44 |
Description: Reusable Plastics; Reusable Funnels |
![]() |
|||
A0420-050 | GenDepot | 495ml | EUR 151 |
![]() |
|||
NAT1184 | National Diagnostics | 450ML | EUR 105 |
![]() |
|||
NAT1186 | National Diagnostics | 1L | EUR 138 |
![]() |
|||
B5247-1 | ApexBio | 1 mg | EUR 609 |
![]() |
|||
GFL-40 | Creative Diagnostics | 1 mL | EUR 1053 |
![]() |
|||
DLR-Ab1-40-Hu-48T | DL Develop | 48T | EUR 479 |
|
|||
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
![]() |
|||
DLR-Ab1-40-Hu-96T | DL Develop | 96T | EUR 621 |
|
|||
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
![]() |
|||
DLR-Ab1-40-Mu-48T | DL Develop | 48T | EUR 489 |
|
|||
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
![]() |
|||
DLR-Ab1-40-Mu-96T | DL Develop | 96T | EUR 635 |
|
|||
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
![]() |
|||
DLR-Ab1-40-Ra-48T | DL Develop | 48T | EUR 508 |
|
|||
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
![]() |
|||
DLR-Ab1-40-Ra-96T | DL Develop | 96T | EUR 661 |
|
|||
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
![]() |
|||
RD-Ab1-40-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 478 |
![]() |
|||
RD-Ab1-40-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 662 |
![]() |
|||
RD-Ab1-40-Mu-48Tests | Reddot Biotech | 48 Tests | EUR 489 |
![]() |
|||
RD-Ab1-40-Mu-96Tests | Reddot Biotech | 96 Tests | EUR 677 |
![]() |
|||
RD-Ab1-40-Ra-48Tests | Reddot Biotech | 48 Tests | EUR 511 |
![]() |
|||
RD-Ab1-40-Ra-96Tests | Reddot Biotech | 96 Tests | EUR 709 |
![]() |
|||
RDR-Ab1-40-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 500 |
![]() |
|||
RDR-Ab1-40-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 692 |
![]() |
|||
RDR-Ab1-40-Mu-48Tests | Reddot Biotech | 48 Tests | EUR 511 |
![]() |
|||
RDR-Ab1-40-Mu-96Tests | Reddot Biotech | 96 Tests | EUR 709 |
![]() |
|||
RDR-Ab1-40-Ra-48Tests | Reddot Biotech | 48 Tests | EUR 534 |
![]() |
|||
RDR-Ab1-40-Ra-96Tests | Reddot Biotech | 96 Tests | EUR 742 |
![]() |
|||
GPK-40 | Creative Diagnostics | 1 kit | EUR 715 |
![]() |
|||
A0006 | Bio Basic | 500ml | EUR 77.84 |
|
![]() |
|||
A1124-1 | ApexBio | 1 mg | EUR 189 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
![]() |
|||
A00094 | ScyTek Laboratories | 6 ml | EUR 220 |
![]() |
|||
A00094.0025 | ScyTek Laboratories | 25 ml | EUR 514 |
![]() |
|||
A20094 | ScyTek Laboratories | 2 ml | EUR 136 |
![]() |
|||
9999-40 | CORNING | 72/pk | EUR 140 |
Description: General Apparatus; Stoppers |
![]() |
|||
K1230-40 | Biovision | EUR 1061 |
![]() |
|||
K1231-40 | Biovision | EUR 1061 |
![]() |
|||
PROTO95750-1 | BosterBio | Regular: 25ug | EUR 317 |
Description: FGF19 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 195 amino acids and having a molecular mass of 21.8 kDa.;The FGF-19 is purified by proprietary chromatographic techniques. |
![]() |
|||
DAL-N-40 | Alpha Diagnostics | 100 ug | EUR 408 |
![]() |
|||
GCK-M-40 | Creative Diagnostics | 1 kit | EUR 757 |
![]() |
|||
GFL-40-CU | Creative Diagnostics | 1mL | EUR 1365 |
![]() |
|||
A08096-1 | BosterBio | 100ul | EUR 397 |
Description: Rabbit Polyclonal Antibody for Claudin-19 Antibody (CLDN19) detection. Tested with WB in Human, Rat. |
![]() |
|||
A10508-1 | BosterBio | 100ul | EUR 397 |
Description: Rabbit Polyclonal Antibody for TCF-19 Antibody (TCF19) detection. Tested with WB in Human, Mouse, Rat. |
![]() |
|||
A05171-1 | BosterBio | 100ul | EUR 397 |
Description: Rabbit Polyclonal Antibody for MMP-19 Antibody (MMP19) detection.tested for WB in Human, Mouse. |
![]() |
|||
APR17075G | Leading Biology | 0.05mg | EUR 484 |
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human KRT19 / CK19 / Cytokeratin 19 (aa21-40). This antibody is tested and proven to work in the following applications: |
![]() |
|||
BR-40-550 | Creative Diagnostics | 25 mL | EUR 720 |
![]() |
|||
BR-40-600 | Creative Diagnostics | 25 mL | EUR 720 |
![]() |
|||
BR-40-650 | Creative Diagnostics | 25 mL | EUR 720 |
![]() |
|||
BR-40-750 | Creative Diagnostics | 25 mL | EUR 720 |
![]() |
|||
BR-40-780 | Creative Diagnostics | 25 mL | EUR 720 |
![]() |
|||
BR-40-808 | Creative Diagnostics | 25 mL | EUR 720 |
![]() |
|||
BR-40-850 | Creative Diagnostics | 25 mL | EUR 720 |
![]() |
|||
19 | Biobase | 96T/Box | Ask for price |
|
|||
Description: ELISA based test for quantitative detection of O (osterone) |
![]() |
|||
DB-103-1 | DB Biotech | 1 ml | EUR 450 |
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated |
![]() |
|||
OR-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
OR-40-600 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
OR-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
OR-40-700 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
OR-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFA-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFA-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFA-40-700 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFA-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFB-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFB-40-600 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFB-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFB-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFC-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFC-40-600 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFC-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFC-40-700 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFC-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFM-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFM-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFM-40-700 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFM-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFN-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFN-40-600 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFN-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFN-40-700 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFN-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RA25009 | Neuromics | 100 ul | EUR 383 |
![]() |
|||
P1050-.1 | ApexBio | 100 µg | EUR 738 |
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis. |
![]() |
|||
P1050-1 | ApexBio | 1 mg | EUR 4156 |
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis. |
![]() |
|||
PROTQ9UHD0-1 | BosterBio | 10ug | EUR 317 |
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant human IL-19 is a 17.9 kDa protein containing 153 amino acid residues. In solution IL-19 exists predominantly as a non-disulfide-linked dimer. |
![]() |
|||
RCG-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCG-40-600 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCG-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCG-40-700 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCG-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCN-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCN-40-600 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCN-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCN-40-700 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCS-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCS-40-600 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCS-40-700 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCS-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFL-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFL-40-600 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFL-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFL-40-700 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RFL-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RGS-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RGS-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RGS-40-700 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RGS-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
EC2050-1 | AssayPro | 96 Well Plate | EUR 417 |
![]() |
|||
RCA-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCA-40-600 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCA-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCA-40-700 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCA-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RCK-40-550 | Creative Diagnostics | 1 kit | EUR 1043 |
![]() |
|||
RCK-40-600 | Creative Diagnostics | 1 kit | EUR 1043 |
![]() |
|||
RCK-40-650 | Creative Diagnostics | 1 kit | EUR 1043 |
![]() |
|||
RCK-40-700 | Creative Diagnostics | 1 kit | EUR 1043 |
![]() |
|||
RCK-40-750 | Creative Diagnostics | 1 kit | EUR 1043 |
![]() |
|||
A1033-1 | ApexBio | 1 mg | EUR 102 |
Description: Protein Kinase C (19-31), (C67H118N26O17), a peptide with the sequence H-ARG-PHE-ALA-ARG-LYS-GLY-SER-LEU-ARG-GLN-LYS-ASN-VAL-OH, MW= 1559.82. |
![]() |
|||
M02101-1 | BosterBio | 100ug/vial | EUR 397 |
Description: Rabbit Monoclonal Cytokeratin 19 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse. |
![]() |
|||
RHA-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RHA-40-600 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RHA-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RHA-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RHG-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RHG-40-600 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RHG-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RHG-40-700 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RHG-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RHM-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RHM-40-600 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RHM-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RHM-40-700 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RHM-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RRG-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RRG-40-600 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RRG-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RRG-40-700 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RRG-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RMG-40-550 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RMG-40-600 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RMG-40-650 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RMG-40-700 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
RMG-40-750 | Creative Diagnostics | 1 mL | EUR 1022 |
![]() |
|||
A1065-1 | ApexBio | 1 mg | EUR 108 |
Description: Sequence: H2N-KVFGRCELAAAMKRHGLD-OHFormula of Egg white lysozyme (19-36) [Gallus gallus]:C86H144N28O23S2Hen egg white lysozyme has a molecular weight of about 14,600 and each molecule comprises 129 amino acid residues1. |
![]() |
|||
20-abx175368 | Abbexa |
|
|
|
![]() |
|||
20-abx175369 | Abbexa |
|
|
|
![]() |
|||
20-abx132222 | Abbexa |
|
|
|
![]() |
|||
4-SPA864Hu02 | Cloud-Clone |
|
|
|
|||
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli |
![]() |
|||
5-00456 | CHI Scientific | 4 x 1mg | Ask for price |
![]() |
|||
HY-P0265 | MedChemExpress | 5mg | EUR 587 |
![]() |
|||
40 | Biobase | 96T/Box | Ask for price |
|
|||
Description: ELISA based test for quantitative detection of MP (Mycoplasma Pneumoniae Antibody IgG) |
![]() |
|||
abx670346-1mg | Abbexa | 1 mg | EUR 523 |
|
![]() |
|||
20-abx652283 | Abbexa |
|
|
|
![]() |
|||
4-CPA864Hu11 | Cloud-Clone |
|
|
|
|||
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
![]() |
|||
4-CPA864Hu21 | Cloud-Clone |
|
|
|
|||
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
![]() |
|||
4-CPA864Hu23 | Cloud-Clone |
|
|
|
|||
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
![]() |
|||
4-CPA864Hu31 | Cloud-Clone |
|
|
|
|||
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
![]() |
|||
4-CPA864Mu11 | Cloud-Clone |
|
|
|
|||
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
![]() |
|||
4-CPA864Mu21 | Cloud-Clone |
|
|
|
|||
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
![]() |
|||
4-CPA864Mu31 | Cloud-Clone |
|
|
|
|||
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
![]() |
|||
4-CPA864Ra11 | Cloud-Clone |
|
|
|
|||
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
![]() |
|||
4-CPA864Ra21 | Cloud-Clone |
|
|
|
|||
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
![]() |
|||
4-CPA864Ra31 | Cloud-Clone |
|
|
|
|||
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
![]() |
|||
STJ150091 | St John's Laboratory | 1 kit | EUR 412 |
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Rat serum, plasma and other biological fluids |
![]() |
|||
201-12-1231 | SunredBio | 96 tests | EUR 440 |
|
|||
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
![]() |
|||
E-EL-H0542 | Elabscience Biotech | 1 plate of 96 wells | EUR 377 |
|
|||
Description: A sandwich ELISA kit for quantitative measurement of Human A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant |
![]() |
|||
E-EL-M0067 | Elabscience Biotech | 1 plate of 96 wells | EUR 377 |
|
|||
Description: A sandwich ELISA kit for quantitative measurement of Mouse A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant |
![]() |
|||
E-EL-MK0477 | Elabscience Biotech | 1 plate of 96 wells | EUR 584 |
|
|||
Description: A sandwich ELISA kit for quantitative measurement of Monkey A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant |
![]() |
|||
E-EL-R1401 | Elabscience Biotech | 1 plate of 96 wells | EUR 377 |
|
|||
Description: A sandwich ELISA kit for quantitative measurement of Rat A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant |
![]() |
|||
CSB-E08299h-24T | Cusabio | 1 plate of 24 wells | EUR 165 |
|
|||
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid (CSF). A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
![]() |
|||
1-CSB-E08299h | Cusabio |
|
|
|
|||
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
![]() |
|||
CSB-E08300m-24T | Cusabio | 1 plate of 24 wells | EUR 165 |
|
|||
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
![]() |
|||
1-CSB-E08300m | Cusabio |
|
|
|
|||
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
![]() |
|||
CSB-E08302r-24T | Cusabio | 1 plate of 24 wells | EUR 165 |
|
|||
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
![]() |
|||
1-CSB-E08302r | Cusabio |
|
|
|
|||
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
![]() |
|||
0030-40-1 | Alpha Diagnostics | 1 kit | EUR 712 |
![]() |
|||
PROTP08727-1 | BosterBio | Regular: 20ug | EUR 317 |
Description: KRT19 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 423 amino acids (1-400) and having a molecular mass of 46.5kDa.;KRT19 is fused to a 23 amino acid His-Tag at N-terminus and purified by proprietary chromatographic techniques. |
![]() |
|||
B2M17-N-1 | Alpha Diagnostics | 1 mg | EUR 286 |