Mouse Insulin C- peptide

Mouse Insulin C- peptide

To Order Now: info@anbioq.org

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-48Tests 48 Tests
EUR 446

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-96Tests 96 Tests
EUR 615

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-48Tests 48 Tests
EUR 465

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-96Tests 96 Tests
EUR 643

Canine C-Peptide ELISA Kit

DLR-C-Peptide-c-48T 48T
EUR 527
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit

DLR-C-Peptide-c-96T 96T
EUR 688
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit

RD-C-Peptide-c-48Tests 48 Tests
EUR 533

Canine C-Peptide ELISA Kit

RD-C-Peptide-c-96Tests 96 Tests
EUR 740

Canine C-Peptide ELISA Kit

RDR-C-Peptide-c-48Tests 48 Tests
EUR 557

Canine C-Peptide ELISA Kit

RDR-C-Peptide-c-96Tests 96 Tests
EUR 774

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-48T 48T
EUR 398
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-96T 96T
EUR 511
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-48T 48T
EUR 467
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-96T 96T
EUR 605
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-48Tests 48 Tests
EUR 387

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-96Tests 96 Tests
EUR 532

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-48Tests 48 Tests
EUR 465

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-96Tests 96 Tests
EUR 643

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-48Tests 48 Tests
EUR 404

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-96Tests 96 Tests
EUR 556

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-48Tests 48 Tests
EUR 486

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-96Tests 96 Tests
EUR 672

Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ]

INSC35-P 500 ug
EUR 347

Insulin Blocking Peptide

AF5109-BP 1mg
EUR 195

Insulin Blocking Peptide

20-abx064168
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg

Insulin Blocking Peptide

20-abx064169
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg

Insulin Peptide (OVA)

20-abx165763
  • EUR 523.00
  • EUR 244.00
  • EUR 1497.00
  • EUR 606.00
  • EUR 384.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Insulin Receptor Blocking Peptide

AF4692-BP 1mg
EUR 195

Insulin Receptor (INSR) Peptide

20-abx266328
  • EUR 495.00
  • EUR 815.00
  • EUR 356.00
  • 10 mg
  • 25 mg
  • 5 mg

Human Insulin B Peptide

abx670051-5mg 5 mg
EUR 356

Insulin; Clone 2D11-H5 (Concentrate)

A00114-C 1 ml
EUR 437

Control/Blocking peptide Mouse BCL-2

BCL21-C 100 ug
EUR 164

Control/Blocking peptide for Mouse Vimentin (Vim)

VIM11-C 100 ug
EUR 164

ELISA kit for Human Insulin-like peptide INSL5,Insulin-like peptide 5

EK2663 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Insulin-like peptide INSL5,Insulin-like peptide 5 in samples from serum, plasma, tissue homogenates and other biological fluids.

Insulin Receptor beta Blocking Peptide

DF6088-BP 1mg
EUR 195

Insulin Receptor (INSR) Blocking Peptide

20-abx062798
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg

Insulin Receptor (INSR) Amide Peptide

20-abx266403
  • EUR 523.00
  • EUR 871.00
  • EUR 384.00
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Receptor (INSR) Blocking Peptide

20-abx161901
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg

Recombinant Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein

IGFBP53-C 100 ul
EUR 286

Mouse Insulin- like peptide INSL6, Insl6 ELISA KIT

ELI-13429m 96 Tests
EUR 865

Mouse Insulin- like peptide INSL5, Insl5 ELISA KIT

ELI-43454m 96 Tests
EUR 865

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

CSB-EL011749MO-24T 1 plate of 24 wells
EUR 165
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

1-CSB-EL011749MO
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit

abx574867-96tests 96 tests
EUR 668

Mouse C-Peptide/ C-Peptide ELISA Kit

E0316Mo 1 Kit
EUR 571

Mouse C-Peptide(C-Peptide) ELISA Kit

EM0947 96T
EUR 476.25
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 0.094 ng/ml

Monoclonal Anti-Human Insulin C-peptide IgG, aff pure

INSC23-M 100 ul
EUR 482

Control/Blocking peptide for Mouse TATA box-binding protein

TATAB11-C 100 ug
EUR 164

Control/Blocking peptide EOMES

EMS11-C 100 ug
EUR 164

Control/Blocking peptide CD40

CD4011-C 100 ug
EUR 164

Phospho-Insulin Receptor (Tyr1355) Blocking Peptide

AF4392-BP 1mg
EUR 195

Insulin Receptor (1142-1153) (Biotin) Peptide

20-abx266416
  • EUR 523.00
  • EUR 871.00
  • EUR 384.00
  • 10 mg
  • 25 mg
  • 5 mg

Control/Blocking peptide for Mouse Neuronal migration protein doublecortin (DCX)

DCX11-C 100 ug
EUR 164

Control/Blocking peptide for Mouse Neurogenic differentation factor 1 (NeuroD1)

NEUD1-C 100 ug
EUR 164

Recombinant Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control

IGFBP33-C 100 ul
EUR 286

Canine Insulin (INS) ELISA Kit

DLR-INS-c-48T 48T
EUR 624
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine Insulin (INS) ELISA Kit

DLR-INS-c-96T 96T
EUR 821
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine Insulin (INS) ELISA Kit

RDR-INS-c-48Tests 48 Tests
EUR 672

Canine Insulin (INS) ELISA Kit

RDR-INS-c-96Tests 96 Tests
EUR 938

Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB

IGFBP13-C 100 ul
EUR 286

Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB

IGFBP23-C 100 ul
EUR 286

Recombinant (NSO) purified Mouse/Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB

IGFBP63-C 100 ul
EUR 286

Recombinant (Sf21) purified Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB

IGFBP73-C 100 ul
EUR 286

C-Peptide ELISA Kit| Mouse C-Peptide ELISA Kit

EF013534 96 Tests
EUR 689

Mouse C- Peptide, connecting peptide ELISA Kit

CELI-66099m 96 Tests
EUR 865

Mouse Connecting Peptide (C-Peptide) ELISA Kit

abx576327-96tests 96 tests
EUR 668

Mouse Connecting Peptide (C-Peptide) ELISA Kit

abx051521-96tests 96 tests
EUR 754

Mouse C-Type Natriuretic Peptide (NPPC) Peptide

20-abx066174
  • EUR 676.00
  • EUR 286.00
  • EUR 2082.00
  • EUR 801.00
  • EUR 481.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Mouse C-Type Natriuretic Peptide (NPPC) Peptide

20-abx066178
  • EUR 676.00
  • EUR 286.00
  • EUR 2082.00
  • EUR 801.00
  • EUR 481.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Mouse Connecting Peptide (C-Peptide) ELISA Kit

abx255287-96tests 96 tests
EUR 668

Mouse Connecting Peptide (C-Peptide) ELISA Kit

20-abx156702
  • EUR 6642.00
  • EUR 3542.00
  • EUR 825.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide

20-abx068858
  • EUR 704.00
  • EUR 286.00
  • EUR 2179.00
  • EUR 843.00
  • EUR 509.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide

20-abx068859
  • EUR 732.00
  • EUR 286.00
  • EUR 2305.00
  • EUR 885.00
  • EUR 523.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Insulin C-terminal Antibody

abx021216-1mg 1 mg
EUR 787

RXFP1 ELISA Kit| Mouse Relaxin/Insulin Like Family Peptide Recep

EF012910 96 Tests
EUR 689

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-192T 192 tests
EUR 1270
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-48 1 plate of 48 wells
EUR 520
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-96 1 plate of 96 wells
EUR 685
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]

INSB25-P 500 ug
EUR 347

Control/Blocking peptide Human BCL-2

BCL11-C 100 ug
EUR 164

IGF-I Receptor/Insulin Receptor Blocking Peptide

AF4697-BP 1mg
EUR 195

Insulin Like Growth Factor 1 (IGF1) Peptide

20-abx266444
  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg

Kinase Domain of Insulin Receptor (2) Peptide

20-abx266448
  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Receptor (1142-1153), amide (Biotin) Peptide

20-abx266464
  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg

Kinase Domain of Insulin Receptor (1) Peptide

20-abx266352
  • EUR 509.00
  • EUR 857.00
  • EUR 370.00
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Receptor (INSR) (Phospho-Y1355) Blocking Peptide

20-abx161651
  • EUR 314.00
  • EUR 509.00
  • 1 mg
  • 5 mg

Insulin Receptor (INSR) (Phospho-Y1361) Blocking Peptide

20-abx161652
  • EUR 314.00
  • EUR 509.00
  • 1 mg
  • 5 mg

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-10ug 10ug
EUR 202
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-1mg 1mg
EUR 2283
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-500ug 500ug
EUR 1613
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-50ug 50ug
EUR 496
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Beta catenin 1 (CTNNB1) Control/Blocking Peptide

BCTN11-C 100 ug
EUR 164

Rabbit anti-Lamin B1 Control/Blocking Peptide

BL11-C 100 ug
EUR 164

Control/Blocking peptide for Ephrin-B2 antibody

NIVE2B-C 100 ug
EUR 164

C-Peptide Blocking Peptide

3277BP-50
EUR 153

Mouse C- Peptide ELISA Kit

ELA-E0447m 96 Tests
EUR 865

Mouse C-Peptide ELISA Kit

CN-02863M1 96T
EUR 458

Mouse C-Peptide ELISA Kit

CN-02863M2 48T
EUR 307

Mouse C peptide ELISA kit

E03C0042-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Mouse C peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse C peptide ELISA kit

E03C0042-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Mouse C peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse C peptide ELISA kit

E03C0042-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Mouse C peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse C-Peptide ELISA Kit

CSB-E05068m-24T 1 plate of 24 wells
EUR 165
Description: Quantitativesandwich ELISA kit for measuring Mouse C-Peptide in samples from serum, plasma. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse C-Peptide ELISA Kit

1-CSB-E05068m
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse C-Peptide in samples from serum, plasma. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse C-Peptide ELISA Kit

GA-E0019MS-48T 48T
EUR 336

Mouse C-Peptide ELISA Kit

GA-E0019MS-96T 96T
EUR 534

Mouse C-Peptide ELISA Kit

EMC0815 96Tests
EUR 521

C-Peptide II (Mouse) antibody

Y223 50 ul
EUR 427
Description: The C-Peptide II (Mouse) antibody is available in Europe and for worldwide shipping via Gentaur.

Mouse C-Peptide ELISA Kit

QY-E20396 96T
EUR 361

Mouse C-Type Natriuretic Peptide (NPPC) Peptide (OVA)

20-abx651254
  • EUR 342.00
  • EUR 217.00
  • EUR 940.00
  • EUR 425.00
  • EUR 286.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Custom Peptide Synthesis (crude and desalted; mg-kg size, price based upon peptide size: 2-100 aa)

PEP-C 1 Ask for price

Control/Blocking peptide for Mouse Microtubule-associated proteins 1A/1B light chain 3B (anti-Map1lc3b)

MAP13B-C 100 ug
EUR 164

C-Peptide

E64I002 0.1mg
EUR 1675

C-Peptide

E64I00201 0.1mg
EUR 424

C-Peptide

RA18034 100 ul
EUR 483

Human Connecting Peptide (C-Peptide) Peptide

abx670072-05mg 0.5 mg
EUR 565

Mouse Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) ELISA Kit

abx390435-96tests 96 tests
EUR 911

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit

abx254542-96tests 96 tests
EUR 707

Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit

EM0166 96T
EUR 524.1
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 9.375pg/ml

Control/Blocking peptide Glutamate receptor ionotropic (NMDA/GRN1)

NMDA11-C 100 ug
EUR 164

Mouse C-Peptide (C-P) CLIA Kit

abx195459-96tests 96 tests
EUR 825

Mouse C-P(C-Peptide) ELISA Kit

STJ150015 1 kit
EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of C-P in Mouse serum, plasma and other biological fluids

Human Insulin- like peptide INSL6, INSL6 ELISA KIT

ELI-12379h 96 Tests
EUR 824

Human Insulin- like peptide INSL5, INSL5 ELISA KIT

ELI-20454h 96 Tests
EUR 824

Bovine Insulin- like peptide INSL6, INSL6 ELISA KIT

ELI-42113b 96 Tests
EUR 928

Human Insulin-like peptide INSL5(INSL5) ELISA kit

CSB-EL011749HU-24T 1 plate of 24 wells
EUR 165
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Insulin-like peptide INSL5(INSL5) ELISA kit

1-CSB-EL011749HU
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human Insulin-like peptide INSL5 (INSL5) ELISA Kit

abx570706-96tests 96 tests
EUR 668

Kinase Domain of Insulin Receptor (2) (Biotin) Peptide

20-abx266404
  • EUR 523.00
  • EUR 871.00
  • EUR 384.00
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Like Growth Factor 1 (IGF1) Analog Peptide

20-abx266295
  • EUR 495.00
  • EUR 815.00
  • EUR 356.00
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Like Growth Factor 1 (IGF1) Blocking Peptide

20-abx161136
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg

Recombinant Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control

IGFBP31-C 100 ul
EUR 286

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate)

RA0164-C.1 0.1 ml
EUR 125

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate)

RA0164-C.5 0.5 ml
EUR 300

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate)

RA0165-C.1 0.1 ml
EUR 125

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate)

RA0165-C.5 0.5 ml
EUR 300

Mouse Insulin ELISA kit

E03I0004-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Mouse Insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Insulin ELISA kit

E03I0004-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Mouse Insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Insulin ELISA kit

E03I0004-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Mouse Insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Insulin-1 (Ins1)

1-CSB-YP355623MO
  • EUR 586.00
  • EUR 299.00
  • EUR 2172.00
  • EUR 900.00
  • EUR 1442.00
  • EUR 382.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Mouse Insulin-1(Ins1) expressed in Yeast

Mouse Insulin-1 (Ins1)

1-CSB-EP355623MO
  • EUR 611.00
  • EUR 309.00
  • EUR 1827.00
  • EUR 939.00
  • EUR 1218.00
  • EUR 397.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Mouse Insulin-1(Ins1) expressed in E.coli

Insulin (Mouse) ELISA Kit

K4271-100
EUR 805

Mouse Insulin ELISA Kit

DEIA1166 96T
EUR 1460
Description: The Mouse Ins ELISA kit is designed to detect and quantify the level of Mouse Ins in cell culture supernatant, serum, plasma and tissue. This kit is for research use only and not intended for diagnostic purposes.

Mouse Insulin (INS) Protein

20-abx067219
  • EUR 648.00
  • EUR 272.00
  • EUR 1998.00
  • EUR 773.00
  • EUR 467.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Chicken C-Peptide/ C-Peptide ELISA Kit

E0016Ch 1 Kit
EUR 717

Dog C-Peptide/ C-Peptide ELISA Kit

E0025Do 1 Kit
EUR 717

Pig C-Peptide/ C-Peptide ELISA Kit

E0044Pi 1 Kit
EUR 717

Rat C-Peptide/ C-Peptide ELISA Kit

E0225Ra 1 Kit
EUR 571

Human C-Peptide/ C-Peptide ELISA Kit

E0546Hu 1 Kit
EUR 537

Canine C Peptide(C Peptide) ELISA Kit

ECA0028 96T
EUR 567.6
Description: Method of detection: Coated with Antigen, Competitive ELISA;Reacts with: Canine;Sensitivity: 0.469 ng/ml

Human C-peptide(C-peptide) Elisa Kit

QY-E05491 96T
EUR 361

Purified human recomb insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control

IGFBP51-C 100 ul
EUR 286

Connecting Peptide (C-Peptide) Antibody

20-abx100155
  • EUR 258.00
  • EUR 133.00
  • EUR 606.00
  • EUR 328.00
  • EUR 230.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Connecting Peptide (C-Peptide) Antibody

abx021134-100ug 100 ug
EUR 481

Connecting Peptide (C-Peptide) Antibody

abx021135-1mg 1 mg
EUR 739

Connecting Peptide (C-Peptide) Antibody

abx022864-01ml 0.1 ml
EUR 578

Connecting Peptide (C-peptide) Antibody

abx023812-1mg 1 mg
EUR 739

Connecting Peptide (C-Peptide) Antibody

abx411178-025mg 0.25 mg
EUR 565

Connecting Peptide (C-Peptide) Antibody

abx414631-02mg 0.2 mg
EUR 565

Connecting Peptide (C-Peptide) Antibody

abx414632-02mg 0.2 mg
EUR 565

Connecting Peptide (C-Peptide) Antibody

abx414633-02mg 0.2 mg
EUR 565

Connecting Peptide (C-Peptide) Antibody

abx414789-02mg 0.2 mg
EUR 565

Connecting Peptide (C-Peptide) Antibody

abx414790-02mg 0.2 mg
EUR 565

Rat Connecting Peptide (C-Peptide) Peptide (OVA)

20-abx651058
  • EUR 425.00
  • EUR 230.00
  • EUR 1149.00
  • EUR 495.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Insulin

RA20056 100 ul
EUR 370

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone 2D11-H5 (INS05) (Concentrate)

RA0161-C.1 0.1 ml
EUR 125

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone 2D11-H5 (INS05) (Concentrate)

RA0161-C.5 0.5 ml
EUR 300

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone E2-E3 (INS04) (Concentrate)

RA0162-C.1 0.1 ml
EUR 125

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone E2-E3 (INS04) (Concentrate)

RA0162-C.5 0.5 ml
EUR 300

Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB

IGFBP11-C 100 ul
EUR 286

Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB

IGFBP22-C 100 ul
EUR 286

Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein control for WB

IGFBP41-C 100 ul
EUR 286

Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB

IGFBP62-C 100 ul
EUR 286

ELISA kit for Mouse RXFP1 (Relaxin/Insulin Like Family Peptide Receptor 1)

E-EL-M1010 1 plate of 96 wells
EUR 534
Description: A sandwich ELISA kit for quantitative measurement of Mouse RXFP1 (Relaxin/Insulin Like Family Peptide Receptor 1) in samples from Serum, Plasma, Cell supernatant

Goat Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure

INSA21-A 100 ul
EUR 482

Monoclonal Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure

INSB22-M 100 ul
EUR 482

Mouse C-Peptide (CP) ELISA Kit

CEA447Mu-10x96wellstestplate 10x96-wells test plate
EUR 4391.16
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse C-Peptide (CP) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse C-Peptide (CP) ELISA Kit

CEA447Mu-1x48wellstestplate 1x48-wells test plate
EUR 449.27
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse C-Peptide (CP) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse C-Peptide (CP) ELISA Kit

CEA447Mu-1x96wellstestplate 1x96-wells test plate
EUR 598.96
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse C-Peptide (CP) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse C-Peptide (CP) ELISA Kit

CEA447Mu-5x96wellstestplate 5x96-wells test plate
EUR 2395.32
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse C-Peptide (CP) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse C-Peptide (CP) ELISA Kit

4-CEA447Mu
  • EUR 4442.00
  • EUR 2346.00
  • EUR 599.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse C-Peptide (CP) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

C-terminal Proghrelin Isoform Peptide, mouse

5-00888 4 x 5mg Ask for price

Mouse C-Peptide (CP) CLIA Kit

20-abx490109
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Mouse C-Peptide ELISA Kit (CP)

RK02705 96 Tests
EUR 521

C-Peptide ELISA Kit (Mouse) (OKCD02261)

OKCD02261 96 Wells
EUR 779
Description: Description of target: Proinsulin C-peptide is the middle segment of proinsulin that is between the N-terminal B-chain and the C-terminal A-chain. It is a pancreatic peptide of about 31 residues, depending on the species. Upon proteolytic cleavage of proinsulin, equimolar INSULIN and C-peptide are released. C-peptide immunoassay has been used to assess pancreatic beta cell function in diabetic patients with circulating insulin antibodies or exogenous insulin. Half-life of C-peptide is 30 min, almost 8 times that of insulin.;Species reactivity: Mouse;Application: ;Assay info: Assay Methodology: Competitive Inhibition Immunoassay;Sensitivity: 37.35 pg/mL

C-Peptide ELISA Kit (Mouse) (OKEH00454)

OKEH00454 96 Wells
EUR 662
Description: Description of target: C-peptide is a protein that is produced in the body along with insulin. First preproinsulin is secreted with an A-chain, C-peptide, a B-chain, and a signal sequence. The signal sequence is cut off, leaving proinsulin. Then the C-peptide is cut off, leaving the A-chain and B-chain to form insulin.;Species reactivity: Mouse;Application: ;Assay info: Assay Methodology: Quantitative Competitive ELISA;Sensitivity: 0.083 ng/mL

ELISA kit for Mouse C-Peptide

EK1778 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Mouse C-Peptide in samples from serum, plasma, tissue homogenates and other biological fluids.

C-terminal Proghrelin Isoform Peptide, mouse

SP-84141-5 5 mg
EUR 286

Recombinant (E. coli) purified Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB

IGFBP72-C 100 ul
EUR 286

CLIA kit for Mouse C-P (C-Peptide)

E-CL-M0227 1 plate of 96 wells
EUR 584
Description: A sandwich CLIA kit for quantitative measurement of Mouse C-P (C-Peptide) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Mouse C-P (C-Peptide)

E-EL-M0354 1 plate of 96 wells
EUR 377
Description: A sandwich ELISA kit for quantitative measurement of Mouse C-P (C-Peptide) in samples from Serum, Plasma, Cell supernatant

Recombinant (NS0) purified Mouse C-Reactive Protein (CRP) cotnrol for Western

CRP21-C 100 ul
EUR 286

Recombinant (NS0) purified Mouse C-Reactive Protein (CRP) cotnrol for Western

CRP24-C 100 ul
EUR 286

Human Early placenta insulin- like peptide, INSL4 ELISA KIT

ELI-03359h 96 Tests
EUR 824

Recombinant Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1)

4-RPB456Hu01
  • EUR 530.08
  • EUR 245.00
  • EUR 1712.80
  • EUR 637.60
  • EUR 1175.20
  • EUR 418.00
  • EUR 4132.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Relaxin/Insulin Like Family Peptide Receptor 1 expressed in: E.coli

Recombinant Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1)

4-RPB456Hu02
  • EUR 504.99
  • EUR 238.00
  • EUR 1618.72
  • EUR 606.24
  • EUR 1112.48
  • EUR 401.00
  • EUR 3896.80
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Relaxin/Insulin Like Family Peptide Receptor 1 expressed in: E.coli

Human Early placenta insulin-like peptide(INSL4) ELISA kit

CSB-EL011748HU-24T 1 plate of 24 wells
EUR 165
Description: Quantitativesandwich ELISA kit for measuring Human Early placenta insulin-like peptide (INSL4) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Early placenta insulin-like peptide(INSL4) ELISA kit

1-CSB-EL011748HU
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human Early placenta insulin-like peptide(INSL4) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human INSL4/ Early placenta insulin-like peptide ELISA Kit

E1323Hu 1 Kit
EUR 571

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx119157
  • EUR 314.00
  • EUR 98.00
  • EUR 398.00
  • EUR 495.00
  • 100 ug
  • 10 ug
  • 200 ug
  • 300 µg

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody

abx122948-100ug 100 ug
EUR 391

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx126504
  • EUR 411.00
  • EUR 592.00
  • EUR 182.00
  • EUR 314.00
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody

20-abx104448
  • EUR 411.00
  • EUR 133.00
  • EUR 1149.00
  • EUR 565.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody

20-abx104449
  • EUR 411.00
  • EUR 133.00
  • EUR 1149.00
  • EUR 565.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide

20-abx062773
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg

Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide

20-abx062774
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody

abx030698-400ul 400 ul
EUR 523

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody

abx030698-80l 80 µl
EUR 286

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

abx030791-400ul 400 ul
EUR 523

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

abx030791-80l 80 µl
EUR 286

RR-SRC, Insulin Receptor Tyrosine Kinase Substrate (Biotin) Peptide

20-abx265690
  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Like Growth Factor 1 (IGF1) (1-3) Peptide

20-abx265710
  • EUR 328.00
  • EUR 495.00
  • EUR 272.00
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Like Growth Factor 1 (IGF1) (30-41) Peptide

20-abx266288
  • EUR 495.00
  • EUR 815.00
  • EUR 356.00
  • 10 mg
  • 25 mg
  • 5 mg

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx321215
  • EUR 439.00
  • EUR 328.00
  • 100 ul
  • 50 ul

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx322026
  • EUR 439.00
  • EUR 328.00
  • 100 ul
  • 50 ul

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody

20-abx218407
  • EUR 425.00
  • EUR 342.00
  • 100 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody

20-abx338522
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx211855
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx212781
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul

Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide

20-abx161890
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx178245
  • EUR 1205.00
  • EUR 578.00
  • 1 mg
  • 200 ug

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx174369
  • EUR 857.00
  • EUR 439.00
  • 1 mg
  • 200 ug

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody

20-abx327281
  • EUR 314.00
  • EUR 244.00
  • 100 ug
  • 50 ug

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody

20-abx328076
  • EUR 314.00
  • EUR 244.00
  • 100 ug
  • 50 ug

ELISA kit for Human Insulin-like peptide INSL6 (INSL6)

KTE62243-48T 48T
EUR 354
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Insulin-like peptide INSL6 (INSL6)

KTE62243-5platesof96wells 5 plates of 96 wells
EUR 2252
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Insulin-like peptide INSL6 (INSL6)

KTE62243-96T 96T
EUR 572
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)

KTE10416-48T 48T
EUR 354
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)

KTE10416-5platesof96wells 5 plates of 96 wells
EUR 2252
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)

KTE10416-96T 96T
EUR 572
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Human INSL4(Early placenta insulin-like peptide) ELISA Kit

EH1173 96T
EUR 567.6
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

Rat IRAP (Insulin regulated aminopeptidase) Control/blocking peptide #1

IRAP11-P 100 ug
EUR 164

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit

DLR-IGF1-c-48T 48T
EUR 474
Description: A sandwich quantitative ELISA assay kit for detection of Canine Insulin Like Growth Factor 1 (IGF1) in samples from serum, plasma or other biological fluids.

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit

DLR-IGF1-c-96T 96T
EUR 614
Description: A sandwich quantitative ELISA assay kit for detection of Canine Insulin Like Growth Factor 1 (IGF1) in samples from serum, plasma or other biological fluids.

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit

RDR-IGF1-c-48Tests 48 Tests
EUR 493

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit

RDR-IGF1-c-96Tests 96 Tests
EUR 683

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit

RD-IGF1-c-48Tests 48 Tests
EUR 472

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit

RD-IGF1-c-96Tests 96 Tests
EUR 653

C-peptide antibody

70R-41552 100 ug
EUR 296
Description: Rabbit polyclonal C-peptide antibody

C Peptide protein

30-AC95L 50 ug
EUR 363
Description: Purified recombinant Human C Peptide protein

Mouse Insulin C- peptide