Mouse Insulin C- peptide

Mouse Insulin C- peptide

To Order Now: info@anbioq.org

Canine C-Peptide ELISA Kit
DLR-C-Peptide-c-96T	DL Develop	96T	EUR 688
Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit
RDR-C-Peptide-c-48Tests	Reddot Biotech	48 Tests	EUR 557

Canine C-Peptide ELISA Kit
RDR-C-Peptide-c-96Tests	Reddot Biotech	96 Tests	EUR 774

Canine C-Peptide ELISA Kit
RD-C-Peptide-c-48Tests	Reddot Biotech	48 Tests	EUR 533

Canine C-Peptide ELISA Kit
RD-C-Peptide-c-96Tests	Reddot Biotech	96 Tests	EUR 740

Mouse C-Peptide ELISA Kit
DLR-C-Peptide-Mu-48T	DL Develop	48T	EUR 450
Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit
DLR-C-Peptide-Mu-96T	DL Develop	96T	EUR 582
Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit
RDR-C-Peptide-Mu-48Tests	Reddot Biotech	48 Tests	EUR 465

Mouse C-Peptide ELISA Kit
RDR-C-Peptide-Mu-96Tests	Reddot Biotech	96 Tests	EUR 643

Mouse C-Peptide ELISA Kit
RD-C-Peptide-Mu-48Tests	Reddot Biotech	48 Tests	EUR 446

Mouse C-Peptide ELISA Kit
RD-C-Peptide-Mu-96Tests	Reddot Biotech	96 Tests	EUR 615

Human C-Peptide ELISA Kit
DLR-C-Peptide-Hu-48T	DL Develop	48T	EUR 398
Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit
DLR-C-Peptide-Hu-96T	DL Develop	96T	EUR 511
Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit
DLR-C-Peptide-Ra-48T	DL Develop	48T	EUR 467
Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit
DLR-C-Peptide-Ra-96T	DL Develop	96T	EUR 605
Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit
RDR-C-Peptide-Hu-48Tests	Reddot Biotech	48 Tests	EUR 404

Human C-Peptide ELISA Kit
RDR-C-Peptide-Hu-96Tests	Reddot Biotech	96 Tests	EUR 556

Rat C-Peptide ELISA Kit
RDR-C-Peptide-Ra-48Tests	Reddot Biotech	48 Tests	EUR 486

Rat C-Peptide ELISA Kit
RDR-C-Peptide-Ra-96Tests	Reddot Biotech	96 Tests	EUR 672

Human C-Peptide ELISA Kit
RD-C-Peptide-Hu-48Tests	Reddot Biotech	48 Tests	EUR 387

Human C-Peptide ELISA Kit
RD-C-Peptide-Hu-96Tests	Reddot Biotech	96 Tests	EUR 532

Rat C-Peptide ELISA Kit
RD-C-Peptide-Ra-48Tests	Reddot Biotech	48 Tests	EUR 465

Rat C-Peptide ELISA Kit
RD-C-Peptide-Ra-96Tests	Reddot Biotech	96 Tests	EUR 643

Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ]
INSC35-P	Alpha Diagnostics	500 ug	EUR 347

Insulin Peptide (OVA)
20-abx165763	Abbexa	EUR 523.00 EUR 244.00 EUR 1497.00 EUR 606.00 EUR 384.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Insulin Blocking Peptide
20-abx064168	Abbexa	EUR 272.00 EUR 411.00	1 mg 5 mg
Shipped within 5-10 working days.

Insulin Blocking Peptide
20-abx064169	Abbexa	EUR 272.00 EUR 411.00	1 mg 5 mg
Shipped within 5-10 working days.

Insulin Blocking Peptide
AF5109-BP	Affbiotech	1mg	EUR 195

Insulin; Clone 2D11-H5 (Concentrate)
A00114-C	ScyTek Laboratories	1 ml	EUR 437

Insulin Receptor (INSR) Peptide
20-abx266328	Abbexa	EUR 495.00 EUR 815.00 EUR 356.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Insulin Receptor Blocking Peptide
AF4692-BP	Affbiotech	1mg	EUR 195

Human Insulin B Peptide
abx670051-5mg	Abbexa	5 mg	EUR 356
Shipped within 1 week.

Control/Blocking peptide Mouse BCL-2
BCL21-C	Alpha Diagnostics	100 ug	EUR 164

Control/Blocking peptide for Mouse Vimentin (Vim)
VIM11-C	Alpha Diagnostics	100 ug	EUR 164

Recombinant Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein
IGFBP53-C	Alpha Diagnostics	100 ul	EUR 286

ELISA kit for Human Insulin-like peptide INSL5,Insulin-like peptide 5
EK2663	SAB	96 tests	EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Insulin-like peptide INSL5,Insulin-like peptide 5 in samples from serum, plasma, tissue homogenates and other biological fluids.

Insulin Receptor beta Blocking Peptide
DF6088-BP	Affbiotech	1mg	EUR 195

Insulin Receptor (INSR) Blocking Peptide
20-abx161901	Abbexa	EUR 272.00 EUR 411.00	1 mg 5 mg
Shipped within 5-10 working days.

Insulin Receptor (INSR) Blocking Peptide
20-abx062798	Abbexa	EUR 272.00 EUR 411.00	1 mg 5 mg
Shipped within 5-10 working days.

Insulin Receptor (INSR) Amide Peptide
20-abx266403	Abbexa	EUR 523.00 EUR 871.00 EUR 384.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Mouse Insulin- like peptide INSL6, Insl6 ELISA KIT
ELI-13429m	Lifescience Market	96 Tests	EUR 865

Mouse Insulin- like peptide INSL5, Insl5 ELISA KIT
ELI-43454m	Lifescience Market	96 Tests	EUR 865

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit
CSB-EL011749MO-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit
1-CSB-EL011749MO	Cusabio	EUR 804.00 EUR 5099.00 EUR 2704.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit
abx574867-96tests	Abbexa	96 tests	EUR 668
Shipped within 1-3 weeks.

Control/Blocking peptide for Mouse TATA box-binding protein
TATAB11-C	Alpha Diagnostics	100 ug	EUR 164

Monoclonal Anti-Human Insulin C-peptide IgG, aff pure
INSC23-M	Alpha Diagnostics	100 ul	EUR 482

Recombinant Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control
IGFBP33-C	Alpha Diagnostics	100 ul	EUR 286

Control/Blocking peptide CD40
CD4011-C	Alpha Diagnostics	100 ug	EUR 164

Control/Blocking peptide EOMES
EMS11-C	Alpha Diagnostics	100 ug	EUR 164

Control/Blocking peptide for Mouse Neuronal migration protein doublecortin (DCX)
DCX11-C	Alpha Diagnostics	100 ug	EUR 164

Control/Blocking peptide for Mouse Neurogenic differentation factor 1 (NeuroD1)
NEUD1-C	Alpha Diagnostics	100 ug	EUR 164

Mouse C-Peptide/ C-Peptide ELISA Kit
E0316Mo	Sunlong	1 Kit	EUR 571

Mouse C-Peptide(C-Peptide) ELISA Kit
EM0947	FN Test	96T	EUR 476.25
Detection range: 0.156-10 ng/ml Alias: C-P(C-Peptide)/Connecting Peptide
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 0.094 ng/ml

Insulin Receptor (1142-1153) (Biotin) Peptide
20-abx266416	Abbexa	EUR 523.00 EUR 871.00 EUR 384.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Phospho-Insulin Receptor (Tyr1355) Blocking Peptide
AF4392-BP	Affbiotech	1mg	EUR 195

Canine Insulin (INS) ELISA Kit
DLR-INS-c-48T	DL Develop	48T	EUR 624
Should the Canine Insulin (INS) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine Insulin (INS) ELISA Kit
DLR-INS-c-96T	DL Develop	96T	EUR 821
Should the Canine Insulin (INS) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine Insulin (INS) ELISA Kit
RDR-INS-c-48Tests	Reddot Biotech	48 Tests	EUR 672

Canine Insulin (INS) ELISA Kit
RDR-INS-c-96Tests	Reddot Biotech	96 Tests	EUR 938

Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB
IGFBP13-C	Alpha Diagnostics	100 ul	EUR 286

Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB
IGFBP23-C	Alpha Diagnostics	100 ul	EUR 286

Recombinant (NSO) purified Mouse/Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB
IGFBP63-C	Alpha Diagnostics	100 ul	EUR 286

Recombinant (Sf21) purified Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB
IGFBP73-C	Alpha Diagnostics	100 ul	EUR 286

Control/Blocking peptide Human BCL-2
BCL11-C	Alpha Diagnostics	100 ug	EUR 164

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide
20-abx068858	Abbexa	EUR 704.00 EUR 286.00 EUR 2179.00 EUR 843.00 EUR 509.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-12 working days.

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide
20-abx068859	Abbexa	EUR 732.00 EUR 286.00 EUR 2305.00 EUR 885.00 EUR 523.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-12 working days.

Insulin Receptor (INSR) (Phospho-Y1355) Blocking Peptide
20-abx161651	Abbexa	EUR 314.00 EUR 509.00	1 mg 5 mg
Shipped within 5-10 working days.

Insulin Receptor (INSR) (Phospho-Y1361) Blocking Peptide
20-abx161652	Abbexa	EUR 314.00 EUR 509.00	1 mg 5 mg
Shipped within 5-10 working days.

Kinase Domain of Insulin Receptor (1) Peptide
20-abx266352	Abbexa	EUR 509.00 EUR 857.00 EUR 370.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Insulin Like Growth Factor 1 (IGF1) Peptide
20-abx266444	Abbexa	EUR 551.00 EUR 926.00 EUR 398.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Kinase Domain of Insulin Receptor (2) Peptide
20-abx266448	Abbexa	EUR 551.00 EUR 926.00 EUR 398.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Insulin Receptor (1142-1153), amide (Biotin) Peptide
20-abx266464	Abbexa	EUR 551.00 EUR 926.00 EUR 398.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

IGF-I Receptor/Insulin Receptor Blocking Peptide
AF4697-BP	Affbiotech	1mg	EUR 195

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E03R0119-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E03R0119-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E03R0119-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

RXFP1 ELISA Kit| Mouse Relaxin/Insulin Like Family Peptide Recep
EF012910	Lifescience Market	96 Tests	EUR 689

Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]
INSB25-P	Alpha Diagnostics	500 ug	EUR 347

Insulin C-terminal Antibody
abx021216-1mg	Abbexa	1 mg	EUR 787
Shipped within 5-10 working days.

Beta catenin 1 (CTNNB1) Control/Blocking Peptide
BCTN11-C	Alpha Diagnostics	100 ug	EUR 164

Rabbit anti-Lamin B1 Control/Blocking Peptide
BL11-C	Alpha Diagnostics	100 ug	EUR 164

Control/Blocking peptide for Ephrin-B2 antibody
NIVE2B-C	Alpha Diagnostics	100 ug	EUR 164

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-10ug	Novoprotein	10ug	EUR 202
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-1mg	Novoprotein	1mg	EUR 2283
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-500ug	Novoprotein	500ug	EUR 1613
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-50ug	Novoprotein	50ug	EUR 496
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Custom Peptide Synthesis (crude and desalted; mg-kg size, price based upon peptide size: 2-100 aa)
PEP-C	Alpha Diagnostics	1	Ask for price

Mouse Connecting Peptide (C-Peptide) ELISA Kit
abx051521-96tests	Abbexa	96 tests	EUR 754
Shipped within 5-10 working days.

Mouse Connecting Peptide (C-Peptide) ELISA Kit
20-abx156702	Abbexa	EUR 6642.00 EUR 3542.00 EUR 825.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Mouse C-Type Natriuretic Peptide (NPPC) Peptide
20-abx066174	Abbexa	EUR 676.00 EUR 286.00 EUR 2082.00 EUR 801.00 EUR 481.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Mouse C-Type Natriuretic Peptide (NPPC) Peptide
20-abx066178	Abbexa	EUR 676.00 EUR 286.00 EUR 2082.00 EUR 801.00 EUR 481.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Mouse Connecting Peptide (C-Peptide) ELISA Kit
abx255287-96tests	Abbexa	96 tests	EUR 668
Shipped within 5-12 working days.

Mouse C- Peptide, connecting peptide ELISA Kit
CELI-66099m	Lifescience Market	96 Tests	EUR 865

Mouse Connecting Peptide (C-Peptide) ELISA Kit
abx576327-96tests	Abbexa	96 tests	EUR 668
Shipped within 5-12 working days.

C-Peptide ELISA Kit| Mouse C-Peptide ELISA Kit
EF013534	Lifescience Market	96 Tests	EUR 689

Control/Blocking peptide for Mouse Microtubule-associated proteins 1A/1B light chain 3B (anti-Map1lc3b)
MAP13B-C	Alpha Diagnostics	100 ug	EUR 164

Recombinant Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control
IGFBP31-C	Alpha Diagnostics	100 ul	EUR 286

Control/Blocking peptide Glutamate receptor ionotropic (NMDA/GRN1)
NMDA11-C	Alpha Diagnostics	100 ug	EUR 164

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate)
RA0164-C.1	ScyTek Laboratories	0.1 ml	EUR 125

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate)
RA0164-C.5	ScyTek Laboratories	0.5 ml	EUR 300

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate)
RA0165-C.1	ScyTek Laboratories	0.1 ml	EUR 125

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate)
RA0165-C.5	ScyTek Laboratories	0.5 ml	EUR 300

Purified human recomb insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control
IGFBP51-C	Alpha Diagnostics	100 ul	EUR 286

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit
abx254542-96tests	Abbexa	96 tests	EUR 707
Shipped within 5-12 working days.

Mouse Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) ELISA Kit
abx390435-96tests	Abbexa	96 tests	EUR 911
Shipped within 5-12 working days.

Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit
EM0166	FN Test	96T	EUR 524.1
Detection range: 15.625-1000 pg/ml Uniprot ID: Q6R6I7 Alias: RXFP1/Relaxin/Insulin Like Family Peptide Receptor 1)
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 9.375pg/ml

Insulin Like Growth Factor 1 (IGF1) Blocking Peptide
20-abx161136	Abbexa	EUR 272.00 EUR 411.00	1 mg 5 mg
Shipped within 5-10 working days.

Insulin Like Growth Factor 1 (IGF1) Analog Peptide
20-abx266295	Abbexa	EUR 495.00 EUR 815.00 EUR 356.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Kinase Domain of Insulin Receptor (2) (Biotin) Peptide
20-abx266404	Abbexa	EUR 523.00 EUR 871.00 EUR 384.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Human Insulin- like peptide INSL6, INSL6 ELISA KIT
ELI-12379h	Lifescience Market	96 Tests	EUR 824

Human Insulin- like peptide INSL5, INSL5 ELISA KIT
ELI-20454h	Lifescience Market	96 Tests	EUR 824

Bovine Insulin- like peptide INSL6, INSL6 ELISA KIT
ELI-42113b	Lifescience Market	96 Tests	EUR 928

Human Insulin-like peptide INSL5(INSL5) ELISA kit
CSB-EL011749HU-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Insulin-like peptide INSL5(INSL5) ELISA kit
1-CSB-EL011749HU	Cusabio	EUR 804.00 EUR 5099.00 EUR 2704.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human Insulin-like peptide INSL5 (INSL5) ELISA Kit
abx570706-96tests	Abbexa	96 tests	EUR 668
Shipped within 1-3 weeks.

Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB
IGFBP11-C	Alpha Diagnostics	100 ul	EUR 286

Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB
IGFBP22-C	Alpha Diagnostics	100 ul	EUR 286

Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein control for WB
IGFBP41-C	Alpha Diagnostics	100 ul	EUR 286

Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB
IGFBP62-C	Alpha Diagnostics	100 ul	EUR 286

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone 2D11-H5 (INS05) (Concentrate)
RA0161-C.1	ScyTek Laboratories	0.1 ml	EUR 125

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone 2D11-H5 (INS05) (Concentrate)
RA0161-C.5	ScyTek Laboratories	0.5 ml	EUR 300

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone E2-E3 (INS04) (Concentrate)
RA0162-C.1	ScyTek Laboratories	0.1 ml	EUR 125

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone E2-E3 (INS04) (Concentrate)
RA0162-C.5	ScyTek Laboratories	0.5 ml	EUR 300

Mouse Insulin-1 (Ins1)
1-CSB-EP355623MO	Cusabio	EUR 611.00 EUR 309.00 EUR 1827.00 EUR 939.00 EUR 1218.00 EUR 397.00	100ug 10ug 1MG 200ug 500ug 50ug
MW: 14.5 kDa Buffer composition: Tris-based buffer with 50% glycerol.
Description: Recombinant Mouse Insulin-1(Ins1) expressed in E.coli

Mouse Insulin ELISA Kit
DEIA1166	Creative Diagnostics	96T	EUR 1460
Description: The Mouse Ins ELISA kit is designed to detect and quantify the level of Mouse Ins in cell culture supernatant, serum, plasma and tissue. This kit is for research use only and not intended for diagnostic purposes.

Mouse Insulin-1 (Ins1)
1-CSB-YP355623MO	Cusabio	EUR 586.00 EUR 299.00 EUR 2172.00 EUR 900.00 EUR 1442.00 EUR 382.00	100ug 10ug 1MG 200ug 500ug 50ug
MW: 13 kDa Buffer composition: Tris-based buffer with 50% glycerol.
Description: Recombinant Mouse Insulin-1(Ins1) expressed in Yeast

Mouse Insulin ELISA kit
E03I0004-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse Insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Insulin ELISA kit
E03I0004-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse Insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Insulin ELISA kit
E03I0004-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse Insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Insulin (INS) Protein
20-abx067219	Abbexa	EUR 648.00 EUR 272.00 EUR 1998.00 EUR 773.00 EUR 467.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Insulin (Mouse) ELISA Kit
K4271-100	Biovision		EUR 805

Mouse C-Type Natriuretic Peptide (NPPC) Peptide (OVA)
20-abx651254	Abbexa	EUR 342.00 EUR 217.00 EUR 940.00 EUR 425.00 EUR 286.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Mouse C-Peptide ELISA Kit
CSB-E05068m-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse C-Peptide in samples from serum, plasma. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse C-Peptide ELISA Kit
1-CSB-E05068m	Cusabio	EUR 804.00 EUR 5099.00 EUR 2704.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse C-Peptide in samples from serum, plasma. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse C peptide ELISA kit
E03C0042-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse C peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse C peptide ELISA kit
E03C0042-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse C peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse C peptide ELISA kit
E03C0042-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse C peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse C- Peptide ELISA Kit
ELA-E0447m	Lifescience Market	96 Tests	EUR 865

Mouse C-Peptide ELISA Kit
CN-02863M1	ChemNorm	96T	EUR 458

Mouse C-Peptide ELISA Kit
CN-02863M2	ChemNorm	48T	EUR 307

Mouse C-Peptide ELISA Kit
EMC0815	Abclonal	96Tests	EUR 521

Mouse C-Peptide ELISA Kit
GA-E0019MS-48T	GenAsia Biotech	48T	EUR 336

Mouse C-Peptide ELISA Kit
GA-E0019MS-96T	GenAsia Biotech	96T	EUR 534

Mouse C-Peptide ELISA Kit
QY-E20396	Qayee Biotechnology	96T	EUR 361

C-Peptide II (Mouse) antibody
Y223	Sceti	50 ul	EUR 427
Description: The C-Peptide II (Mouse) antibody is available in Europe and for worldwide shipping via Gentaur.

C-Peptide Blocking Peptide
3277BP-50	Biovision		EUR 153

Recombinant (E. coli) purified Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB
IGFBP72-C	Alpha Diagnostics	100 ul	EUR 286

Human Connecting Peptide (C-Peptide) Peptide
abx670072-05mg	Abbexa	0.5 mg	EUR 565
Shipped within 1 week.

Insulin
RA20056	Neuromics	100 ul	EUR 370

C-Peptide
E64I002	EnoGene	0.1mg	EUR 1675

C-Peptide
E64I00201	EnoGene	0.1mg	EUR 424

C-Peptide
RA18034	Neuromics	100 ul	EUR 483

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit
DLR-IGF1-c-48T	DL Develop	48T	EUR 474
Should the Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Canine Insulin Like Growth Factor 1 (IGF1) in samples from serum, plasma or other biological fluids.

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit
DLR-IGF1-c-96T	DL Develop	96T	EUR 614
Should the Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Canine Insulin Like Growth Factor 1 (IGF1) in samples from serum, plasma or other biological fluids.

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit
RDR-IGF1-c-48Tests	Reddot Biotech	48 Tests	EUR 493

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit
RDR-IGF1-c-96Tests	Reddot Biotech	96 Tests	EUR 683

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit
RD-IGF1-c-48Tests	Reddot Biotech	48 Tests	EUR 472

Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit
RD-IGF1-c-96Tests	Reddot Biotech	96 Tests	EUR 653

Mouse C-Peptide (C-P) CLIA Kit
abx195459-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

Mouse C-P(C-Peptide) ELISA Kit
STJ150015	St John's Laboratory	1 kit	EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of C-P in Mouse serum, plasma and other biological fluids

ELISA kit for Mouse RXFP1 (Relaxin/Insulin Like Family Peptide Receptor 1)
E-EL-M1010	Elabscience Biotech	1 plate of 96 wells	EUR 534
Gentaur's RXFP1 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Mouse RXFP1. Standards or samples are added to the micro ELISA plate wells and combined with Show more
Description: A sandwich ELISA kit for quantitative measurement of Mouse RXFP1 (Relaxin/Insulin Like Family Peptide Receptor 1) in samples from Serum, Plasma, Cell supernatant

Goat Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure
INSA21-A	Alpha Diagnostics	100 ul	EUR 482

Monoclonal Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure
INSB22-M	Alpha Diagnostics	100 ul	EUR 482

Recombinant (NS0) purified Mouse C-Reactive Protein (CRP) cotnrol for Western
CRP21-C	Alpha Diagnostics	100 ul	EUR 286

Recombinant (NS0) purified Mouse C-Reactive Protein (CRP) cotnrol for Western
CRP24-C	Alpha Diagnostics	100 ul	EUR 286

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody
20-abx218407	Abbexa	EUR 425.00 EUR 342.00	100 ug 50 ug
Shipped within 5-10 working days.

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx178245	Abbexa	EUR 1205.00 EUR 578.00	1 mg 200 ug
Please enquire.

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx211855	Abbexa	EUR 411.00 EUR 300.00	100 ul 50 ul
Shipped within 5-10 working days.

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx212781	Abbexa	EUR 411.00 EUR 300.00	100 ul 50 ul
Shipped within 5-10 working days.

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody
20-abx104448	Abbexa	EUR 411.00 EUR 133.00 EUR 1149.00 EUR 565.00 EUR 314.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody
20-abx104449	Abbexa	EUR 411.00 EUR 133.00 EUR 1149.00 EUR 565.00 EUR 314.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx119157	Abbexa	EUR 314.00 EUR 98.00 EUR 398.00 EUR 495.00	100 ug 10 ug 200 ug 300 µg
Shipped within 5-10 working days.

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody
abx122948-100ug	Abbexa	100 ug	EUR 391
Shipped within 5-10 working days.

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx126504	Abbexa	EUR 411.00 EUR 592.00 EUR 182.00 EUR 314.00	100 ul 200 ul 20 ul 50 ul
Shipped within 5-10 working days.

Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide
20-abx161890	Abbexa	EUR 272.00 EUR 411.00	1 mg 5 mg
Shipped within 5-10 working days.

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx174369	Abbexa	EUR 857.00 EUR 439.00	1 mg 200 ug
Please enquire.

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody
abx030698-400ul	Abbexa	400 ul	EUR 523
Shipped within 5-10 working days.

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody
abx030698-80l	Abbexa	80 µl	EUR 286
Shipped within 5-10 working days.

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
abx030791-400ul	Abbexa	400 ul	EUR 523
Shipped within 5-10 working days.

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
abx030791-80l	Abbexa	80 µl	EUR 286
Shipped within 5-10 working days.

Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide
20-abx062773	Abbexa	EUR 272.00 EUR 411.00	1 mg 5 mg
Shipped within 5-10 working days.

Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide
20-abx062774	Abbexa	EUR 272.00 EUR 411.00	1 mg 5 mg
Shipped within 5-10 working days.

RR-SRC, Insulin Receptor Tyrosine Kinase Substrate (Biotin) Peptide
20-abx265690	Abbexa	EUR 551.00 EUR 926.00 EUR 398.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Insulin Like Growth Factor 1 (IGF1) (1-3) Peptide
20-abx265710	Abbexa	EUR 328.00 EUR 495.00 EUR 272.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Insulin Like Growth Factor 1 (IGF1) (30-41) Peptide
20-abx266288	Abbexa	EUR 495.00 EUR 815.00 EUR 356.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Human INSL4/ Early placenta insulin-like peptide ELISA Kit
E1323Hu	Sunlong	1 Kit	EUR 571

Human INSL4(Early placenta insulin-like peptide) ELISA Kit
EH1173	FN Test	96T	EUR 567.6
Detection range: 0.312-20 ng/ml Uniprot ID: Q14641 Alias: INSL4/EPIL(Early placenta insulin-like peptide)/Placentin/insulin-like 4(placenta)/Insulin-like peptide 4/Placentin
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

Human Early placenta insulin- like peptide, INSL4 ELISA KIT
ELI-03359h	Lifescience Market	96 Tests	EUR 824

Human Early placenta insulin-like peptide(INSL4) ELISA kit
CSB-EL011748HU-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Early placenta insulin-like peptide (INSL4) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Early placenta insulin-like peptide(INSL4) ELISA kit
1-CSB-EL011748HU	Cusabio	EUR 804.00 EUR 5099.00 EUR 2704.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Early placenta insulin-like peptide(INSL4) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx321215	Abbexa	EUR 439.00 EUR 328.00	100 ul 50 ul
Shipped within 5-10 working days.

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx327281	Abbexa	EUR 314.00 EUR 244.00	100 ug 50 ug
Shipped within 5-10 working days.

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody
20-abx328076	Abbexa	EUR 314.00 EUR 244.00	100 ug 50 ug
Shipped within 5-10 working days.

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody
20-abx338522	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx322026	Abbexa	EUR 439.00 EUR 328.00	100 ul 50 ul
Shipped within 5-10 working days.

ELISA kit for Human Insulin-like peptide INSL6 (INSL6)
KTE62243-48T	Abbkine	48T	EUR 354
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Insulin-like peptide INSL6 (INSL6)
KTE62243-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2252
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Insulin-like peptide INSL6 (INSL6)
KTE62243-96T	Abbkine	96T	EUR 572
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Rat IRAP (Insulin regulated aminopeptidase) Control/blocking peptide #1
IRAP11-P	Alpha Diagnostics	100 ug	EUR 164

ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)
KTE10416-48T	Abbkine	48T	EUR 354
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)
KTE10416-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2252
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)
KTE10416-96T	Abbkine	96T	EUR 572
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Recombinant Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1)
4-RPB456Hu01	Cloud-Clone	EUR 530.08 EUR 245.00 EUR 1712.80 EUR 637.60 EUR 1175.20 EUR 418.00 EUR 4132.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Q9HBX9 Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 18.9kDa Isoelectric Point: 8.9
Description: Recombinant Human Relaxin/Insulin Like Family Peptide Receptor 1 expressed in: E.coli

Recombinant Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1)
4-RPB456Hu02	Cloud-Clone	EUR 504.99 EUR 238.00 EUR 1618.72 EUR 606.24 EUR 1112.48 EUR 401.00 EUR 3896.80	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Q9HBX9 Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 19.2kDa Isoelectric Point: 19.2kDa
Description: Recombinant Human Relaxin/Insulin Like Family Peptide Receptor 1 expressed in: E.coli

Chicken C-Peptide/ C-Peptide ELISA Kit
E0016Ch	Sunlong	1 Kit	EUR 717

Dog C-Peptide/ C-Peptide ELISA Kit
E0025Do	Sunlong	1 Kit	EUR 717

Pig C-Peptide/ C-Peptide ELISA Kit
E0044Pi	Sunlong	1 Kit	EUR 717

Human C-Peptide/ C-Peptide ELISA Kit
E0546Hu	Sunlong	1 Kit	EUR 537

Rat C-Peptide/ C-Peptide ELISA Kit
E0225Ra	Sunlong	1 Kit	EUR 571

Canine C Peptide(C Peptide) ELISA Kit
ECA0028	FN Test	96T	EUR 567.6
Detection range: 0.781-50 ng/ml Alias: C Peptide
Description: Method of detection: Coated with Antigen, Competitive ELISA;Reacts with: Canine;Sensitivity: 0.469 ng/ml

Human C-peptide(C-peptide) Elisa Kit
QY-E05491	Qayee Biotechnology	96T	EUR 361

Rat Connecting Peptide (C-Peptide) Peptide (OVA)
20-abx651058	Abbexa	EUR 425.00 EUR 230.00 EUR 1149.00 EUR 495.00 EUR 314.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Connecting Peptide (C-Peptide) Antibody
abx022864-01ml	Abbexa	0.1 ml	EUR 578
Shipped within 5-10 working days.

Connecting Peptide (C-peptide) Antibody
abx023812-1mg	Abbexa	1 mg	EUR 739
Shipped within 5-10 working days.

Connecting Peptide (C-Peptide) Antibody
abx021134-100ug	Abbexa	100 ug	EUR 481
Shipped within 5-10 working days.

Connecting Peptide (C-Peptide) Antibody
abx021135-1mg	Abbexa	1 mg	EUR 739
Shipped within 5-10 working days.

Connecting Peptide (C-Peptide) Antibody
20-abx100155	Abbexa	EUR 258.00 EUR 133.00 EUR 606.00 EUR 328.00 EUR 230.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Connecting Peptide (C-Peptide) Antibody
abx411178-025mg	Abbexa	0.25 mg	EUR 565
Shipped within 1 week.

Connecting Peptide (C-Peptide) Antibody
abx414631-02mg	Abbexa	0.2 mg	EUR 565
Shipped within 1 week.

Connecting Peptide (C-Peptide) Antibody
abx414632-02mg	Abbexa	0.2 mg	EUR 565
Shipped within 1 week.

Connecting Peptide (C-Peptide) Antibody
abx414633-02mg	Abbexa	0.2 mg	EUR 565
Shipped within 1 week.

Connecting Peptide (C-Peptide) Antibody
abx414789-02mg	Abbexa	0.2 mg	EUR 565
Shipped within 1 week.

Connecting Peptide (C-Peptide) Antibody
abx414790-02mg	Abbexa	0.2 mg	EUR 565
Shipped within 1 week.

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone E2-E3 & 2D11-H5 (INS04 & INS05) (Concentrate)
RA0163-C.1	ScyTek Laboratories	0.1 ml	EUR 125

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone E2-E3 & 2D11-H5 (INS04 & INS05) (Concentrate)
RA0163-C.5	ScyTek Laboratories	0.5 ml	EUR 300

C-terminal Proghrelin Isoform Peptide, mouse
5-00888	CHI Scientific	4 x 5mg	Ask for price

ELISA kit for Mouse C-Peptide
EK1778	SAB	96 tests	EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Mouse C-Peptide in samples from serum, plasma, tissue homogenates and other biological fluids.

Mouse C-Peptide (CP) ELISA Kit
CEA447Mu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4391.16
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse C-Peptide (CP) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse C-Peptide (CP) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse C-Peptide (CP) ELISA Kit
CEA447Mu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 449.27
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse C-Peptide (CP) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse C-Peptide (CP) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse C-Peptide (CP) ELISA Kit
CEA447Mu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 598.96
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse C-Peptide (CP) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse C-Peptide (CP) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse C-Peptide (CP) ELISA Kit
CEA447Mu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2395.32
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse C-Peptide (CP) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse C-Peptide (CP) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse C-Peptide (CP) ELISA Kit
4-CEA447Mu	Cloud-Clone	EUR 4442.00 EUR 2346.00 EUR 599.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as C-Peptide elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse C-Peptide (CP) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Mouse C-Peptide (CP) CLIA Kit
20-abx490109	Abbexa	EUR 7973.00 EUR 4246.00 EUR 981.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

Mouse C-Peptide ELISA Kit (CP)
RK02705	Abclonal	96 Tests	EUR 521

C-terminal Proghrelin Isoform Peptide, mouse
SP-84141-5	Alpha Diagnostics	5 mg	EUR 286

C-Peptide ELISA Kit (Mouse) (OKCD02261)
OKCD02261	Aviva Systems Biology	96 Wells	EUR 779
Description: Description of target: Proinsulin C-peptide is the middle segment of proinsulin that is between the N-terminal B-chain and the C-terminal A-chain. It is a pancreatic peptide of about 31 residues, depending on the species. Upon proteolytic cleavage of proinsulin, equimolar INSULIN and C-peptide are released. C-peptide immunoassay has been used to assess pancreatic beta cell function in diabetic patients with circulating insulin antibodies or exogenous insulin. Half-life of C-peptide is 30 min, almost 8 times that of insulin.;Species reactivity: Mouse;Application: ;Assay info: Assay Methodology: Competitive Inhibition Immunoassay;Sensitivity: 37.35 pg/mL

C-Peptide ELISA Kit (Mouse) (OKEH00454)
OKEH00454	Aviva Systems Biology	96 Wells	EUR 662
Description: Description of target: C-peptide is a protein that is produced in the body along with insulin. First preproinsulin is secreted with an A-chain, C-peptide, a B-chain, and a signal sequence. The signal sequence is cut off, leaving proinsulin. Then the C-peptide is cut off, leaving the A-chain and B-chain to form insulin.;Species reactivity: Mouse;Application: ;Assay info: Assay Methodology: Quantitative Competitive ELISA;Sensitivity: 0.083 ng/mL

Mouse Insulin (INS) ELISA Kit
DLR-INS-Mu-48T	DL Develop	48T	EUR 489
Should the Mouse Insulin (INS) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse Insulin C- peptide