Mouse Insulin C- peptide

Mouse Insulin C- peptide

To Order Now:

Canine C-Peptide ELISA Kit
DLR-C-Peptide-c-96T 96T
EUR 688
  • Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Canine C-Peptide ELISA Kit
RD-C-Peptide-c-48Tests 48 Tests
EUR 533
Canine C-Peptide ELISA Kit
RD-C-Peptide-c-96Tests 96 Tests
EUR 740
Canine C-Peptide ELISA Kit
RDR-C-Peptide-c-48Tests 48 Tests
EUR 557
Canine C-Peptide ELISA Kit
RDR-C-Peptide-c-96Tests 96 Tests
EUR 774
Mouse C-Peptide ELISA Kit
DLR-C-Peptide-Mu-48T 48T
EUR 450
  • Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Mouse C-Peptide ELISA Kit
DLR-C-Peptide-Mu-96T 96T
EUR 582
  • Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Mouse C-Peptide ELISA Kit
RD-C-Peptide-Mu-48Tests 48 Tests
EUR 446
Mouse C-Peptide ELISA Kit
RD-C-Peptide-Mu-96Tests 96 Tests
EUR 615
Mouse C-Peptide ELISA Kit
RDR-C-Peptide-Mu-48Tests 48 Tests
EUR 465
Mouse C-Peptide ELISA Kit
RDR-C-Peptide-Mu-96Tests 96 Tests
EUR 643
Human C-Peptide ELISA Kit
DLR-C-Peptide-Hu-48T 48T
EUR 398
  • Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Human C-Peptide ELISA Kit
DLR-C-Peptide-Hu-96T 96T
EUR 511
  • Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Rat C-Peptide ELISA Kit
DLR-C-Peptide-Ra-48T 48T
EUR 467
  • Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Rat C-Peptide ELISA Kit
DLR-C-Peptide-Ra-96T 96T
EUR 605
  • Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Human C-Peptide ELISA Kit
RD-C-Peptide-Hu-48Tests 48 Tests
EUR 387
Human C-Peptide ELISA Kit
RD-C-Peptide-Hu-96Tests 96 Tests
EUR 532
Rat C-Peptide ELISA Kit
RD-C-Peptide-Ra-48Tests 48 Tests
EUR 465
Rat C-Peptide ELISA Kit
RD-C-Peptide-Ra-96Tests 96 Tests
EUR 643
Human C-Peptide ELISA Kit
RDR-C-Peptide-Hu-48Tests 48 Tests
EUR 404
Human C-Peptide ELISA Kit
RDR-C-Peptide-Hu-96Tests 96 Tests
EUR 556
Rat C-Peptide ELISA Kit
RDR-C-Peptide-Ra-48Tests 48 Tests
EUR 486
Rat C-Peptide ELISA Kit
RDR-C-Peptide-Ra-96Tests 96 Tests
EUR 672
Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ]
INSC35-P 500 ug
EUR 347
Insulin Blocking Peptide
AF5109-BP 1mg
EUR 195
Insulin Blocking Peptide
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.
Insulin Blocking Peptide
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.
Insulin Peptide (OVA)
  • EUR 523.00
  • EUR 244.00
  • EUR 1497.00
  • EUR 606.00
  • EUR 384.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Insulin; Clone 2D11-H5 (Concentrate)
A00114-C 1 ml
EUR 437
Insulin Receptor Blocking Peptide
AF4692-BP 1mg
EUR 195
Human Insulin B Peptide
abx670051-5mg 5 mg
EUR 356
  • Shipped within 1 week.
Insulin Receptor (INSR) Peptide
  • EUR 495.00
  • EUR 815.00
  • EUR 356.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.
Control/Blocking peptide Mouse BCL-2
BCL21-C 100 ug
EUR 164
Control/Blocking peptide for Mouse Vimentin (Vim)
VIM11-C 100 ug
EUR 164
Recombinant Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein
IGFBP53-C 100 ul
EUR 286
ELISA kit for Human Insulin-like peptide INSL5,Insulin-like peptide 5
EK2663 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Insulin-like peptide INSL5,Insulin-like peptide 5 in samples from serum, plasma, tissue homogenates and other biological fluids.
Insulin Receptor (INSR) Blocking Peptide
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.
Insulin Receptor (INSR) Blocking Peptide
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.
Insulin Receptor (INSR) Amide Peptide
  • EUR 523.00
  • EUR 871.00
  • EUR 384.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.
Insulin Receptor beta Blocking Peptide
DF6088-BP 1mg
EUR 195
Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit
abx574867-96tests 96 tests
EUR 668
  • Shipped within 1-3 weeks.
Mouse Insulin- like peptide INSL6, Insl6 ELISA KIT
ELI-13429m 96 Tests
EUR 865
Mouse Insulin- like peptide INSL5, Insl5 ELISA KIT
ELI-43454m 96 Tests
EUR 865
Mouse Insulin-like peptide INSL5(INSL5) ELISA kit
CSB-EL011749MO-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Mouse Insulin-like peptide INSL5(INSL5) ELISA kit
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Control/Blocking peptide for Mouse TATA box-binding protein
TATAB11-C 100 ug
EUR 164
Monoclonal Anti-Human Insulin C-peptide IgG, aff pure
INSC23-M 100 ul
EUR 482
Recombinant Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control
IGFBP33-C 100 ul
EUR 286
Control/Blocking peptide CD40
CD4011-C 100 ug
EUR 164
Control/Blocking peptide EOMES
EMS11-C 100 ug
EUR 164
Control/Blocking peptide for Mouse Neuronal migration protein doublecortin (DCX)
DCX11-C 100 ug
EUR 164
Control/Blocking peptide for Mouse Neurogenic differentation factor 1 (NeuroD1)
NEUD1-C 100 ug
EUR 164
Mouse C-Peptide/ C-Peptide ELISA Kit
E0316Mo 1 Kit
EUR 571
Mouse C-Peptide(C-Peptide) ELISA Kit
EM0947 96T
EUR 476.25
  • Detection range: 0.156-10 ng/ml
  • Alias: C-P(C-Peptide)/Connecting Peptide
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 0.094 ng/ml
Phospho-Insulin Receptor (Tyr1355) Blocking Peptide
AF4392-BP 1mg
EUR 195
Insulin Receptor (1142-1153) (Biotin) Peptide
  • EUR 523.00
  • EUR 871.00
  • EUR 384.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.
Canine Insulin (INS) ELISA Kit
DLR-INS-c-48T 48T
EUR 624
  • Should the Canine Insulin (INS) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Canine Insulin (INS) ELISA Kit
DLR-INS-c-96T 96T
EUR 821
  • Should the Canine Insulin (INS) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Canine Insulin (INS) ELISA Kit
RDR-INS-c-48Tests 48 Tests
EUR 672
Canine Insulin (INS) ELISA Kit
RDR-INS-c-96Tests 96 Tests
EUR 938
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB
IGFBP13-C 100 ul
EUR 286
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB
IGFBP23-C 100 ul
EUR 286
Recombinant (NSO) purified Mouse/Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB
IGFBP63-C 100 ul
EUR 286
Recombinant (Sf21) purified Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB
IGFBP73-C 100 ul
EUR 286
Control/Blocking peptide Human BCL-2
BCL11-C 100 ug
EUR 164
Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide
  • EUR 704.00
  • EUR 286.00
  • EUR 2179.00
  • EUR 843.00
  • EUR 509.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-12 working days.
Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide
  • EUR 732.00
  • EUR 286.00
  • EUR 2305.00
  • EUR 885.00
  • EUR 523.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-12 working days.
IGF-I Receptor/Insulin Receptor Blocking Peptide
AF4697-BP 1mg
EUR 195
Insulin Receptor (INSR) (Phospho-Y1355) Blocking Peptide
  • EUR 314.00
  • EUR 509.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.
Insulin Receptor (INSR) (Phospho-Y1361) Blocking Peptide
  • EUR 314.00
  • EUR 509.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.
Kinase Domain of Insulin Receptor (1) Peptide
  • EUR 509.00
  • EUR 857.00
  • EUR 370.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.
Insulin Like Growth Factor 1 (IGF1) Peptide
  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.
Kinase Domain of Insulin Receptor (2) Peptide
  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.
Insulin Receptor (1142-1153), amide (Biotin) Peptide
  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E03R0119-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E03R0119-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E03R0119-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
RXFP1 ELISA Kit| Mouse Relaxin/Insulin Like Family Peptide Recep
EF012910 96 Tests
EUR 689
Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]
INSB25-P 500 ug
EUR 347
Insulin C-terminal Antibody
abx021216-1mg 1 mg
EUR 787
  • Shipped within 5-10 working days.
Rabbit anti-Lamin B1 Control/Blocking Peptide
BL11-C 100 ug
EUR 164
Beta catenin 1 (CTNNB1) Control/Blocking Peptide
BCTN11-C 100 ug
EUR 164
Control/Blocking peptide for Ephrin-B2 antibody
NIVE2B-C 100 ug
EUR 164
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-10ug 10ug
EUR 202
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-1mg 1mg
EUR 2283
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-500ug 500ug
EUR 1613
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-50ug 50ug
EUR 496
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.
Custom Peptide Synthesis (crude and desalted; mg-kg size, price based upon peptide size: 2-100 aa)
PEP-C 1 Ask for price
Mouse Connecting Peptide (C-Peptide) ELISA Kit
abx576327-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.
Mouse C-Type Natriuretic Peptide (NPPC) Peptide
  • EUR 676.00
  • EUR 286.00
  • EUR 2082.00
  • EUR 801.00
  • EUR 481.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Mouse C-Type Natriuretic Peptide (NPPC) Peptide
  • EUR 676.00
  • EUR 286.00
  • EUR 2082.00
  • EUR 801.00
  • EUR 481.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Mouse Connecting Peptide (C-Peptide) ELISA Kit
  • EUR 6642.00
  • EUR 3542.00
  • EUR 825.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.
Mouse Connecting Peptide (C-Peptide) ELISA Kit
abx051521-96tests 96 tests
EUR 754
  • Shipped within 5-10 working days.
Mouse Connecting Peptide (C-Peptide) ELISA Kit
abx255287-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.
Mouse C- Peptide, connecting peptide ELISA Kit
CELI-66099m 96 Tests
EUR 865
C-Peptide ELISA Kit| Mouse C-Peptide ELISA Kit
EF013534 96 Tests
EUR 689
Control/Blocking peptide for Mouse Microtubule-associated proteins 1A/1B light chain 3B (anti-Map1lc3b)
MAP13B-C 100 ug
EUR 164
Recombinant Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control
IGFBP31-C 100 ul
EUR 286
Control/Blocking peptide Glutamate receptor ionotropic (NMDA/GRN1)
NMDA11-C 100 ug
EUR 164
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate)
RA0164-C.1 0.1 ml
EUR 125
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate)
RA0164-C.5 0.5 ml
EUR 300
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate)
RA0165-C.1 0.1 ml
EUR 125
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate)
RA0165-C.5 0.5 ml
EUR 300
Purified human recomb insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control
IGFBP51-C 100 ul
EUR 286
Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit
EM0166 96T
EUR 524.1
  • Detection range: 15.625-1000 pg/ml
  • Uniprot ID: Q6R6I7
  • Alias: RXFP1/Relaxin/Insulin Like Family Peptide Receptor 1)
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 9.375pg/ml
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit
abx254542-96tests 96 tests
EUR 707
  • Shipped within 5-12 working days.
Mouse Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) ELISA Kit
abx390435-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.
Human Insulin-like peptide INSL5 (INSL5) ELISA Kit
abx570706-96tests 96 tests
EUR 668
  • Shipped within 1-3 weeks.
Human Insulin- like peptide INSL6, INSL6 ELISA KIT
ELI-12379h 96 Tests
EUR 824
Human Insulin- like peptide INSL5, INSL5 ELISA KIT
ELI-20454h 96 Tests
EUR 824
Bovine Insulin- like peptide INSL6, INSL6 ELISA KIT
ELI-42113b 96 Tests
EUR 928
Insulin Like Growth Factor 1 (IGF1) Blocking Peptide
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.
Insulin Like Growth Factor 1 (IGF1) Analog Peptide
  • EUR 495.00
  • EUR 815.00
  • EUR 356.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.
Kinase Domain of Insulin Receptor (2) (Biotin) Peptide
  • EUR 523.00
  • EUR 871.00
  • EUR 384.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.
Human Insulin-like peptide INSL5(INSL5) ELISA kit
CSB-EL011749HU-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Human Insulin-like peptide INSL5(INSL5) ELISA kit
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB
IGFBP11-C 100 ul
EUR 286
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB
IGFBP22-C 100 ul
EUR 286
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-4 (IGFBP-4) protein control for WB
IGFBP41-C 100 ul
EUR 286
Recombinant (NSO) purified Human Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB
IGFBP62-C 100 ul
EUR 286
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone 2D11-H5 (INS05) (Concentrate)
RA0161-C.1 0.1 ml
EUR 125
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone 2D11-H5 (INS05) (Concentrate)
RA0161-C.5 0.5 ml
EUR 300
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone E2-E3 (INS04) (Concentrate)
RA0162-C.1 0.1 ml
EUR 125
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone E2-E3 (INS04) (Concentrate)
RA0162-C.5 0.5 ml
EUR 300
Mouse C-Type Natriuretic Peptide (NPPC) Peptide (OVA)
  • EUR 342.00
  • EUR 217.00
  • EUR 940.00
  • EUR 425.00
  • EUR 286.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Mouse C peptide ELISA kit
E03C0042-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse C peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse C peptide ELISA kit
E03C0042-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse C peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse C peptide ELISA kit
E03C0042-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse C peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse C- Peptide ELISA Kit
ELA-E0447m 96 Tests
EUR 865
Mouse C-Peptide ELISA Kit
GA-E0019MS-48T 48T
EUR 336
Mouse C-Peptide ELISA Kit
GA-E0019MS-96T 96T
EUR 534
Mouse C-Peptide ELISA Kit
EMC0815 96Tests
EUR 521
Mouse C-Peptide ELISA Kit
CSB-E05068m-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse C-Peptide in samples from serum, plasma. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Mouse C-Peptide ELISA Kit
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse C-Peptide in samples from serum, plasma. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Mouse C-Peptide ELISA Kit
CN-02863M1 96T
EUR 458
Mouse C-Peptide ELISA Kit
CN-02863M2 48T
EUR 307
Mouse C-Peptide ELISA Kit
QY-E20396 96T
EUR 361
C-Peptide II (Mouse) antibody
Y223 50 ul
EUR 427
Description: The C-Peptide II (Mouse) antibody is available in Europe and for worldwide shipping via Gentaur.
Mouse Insulin ELISA kit
E03I0004-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse Insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Insulin ELISA kit
E03I0004-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse Insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Insulin ELISA kit
E03I0004-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse Insulin in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Insulin (INS) Protein
  • EUR 648.00
  • EUR 272.00
  • EUR 1998.00
  • EUR 773.00
  • EUR 467.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Insulin (Mouse) ELISA Kit
EUR 805
Mouse Insulin ELISA Kit
DEIA1166 96T
EUR 1460
Description: The Mouse Ins ELISA kit is designed to detect and quantify the level of Mouse Ins in cell culture supernatant, serum, plasma and tissue. This kit is for research use only and not intended for diagnostic purposes.
Mouse Insulin-1 (Ins1)
  • EUR 586.00
  • EUR 299.00
  • EUR 2172.00
  • EUR 900.00
  • EUR 1442.00
  • EUR 382.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
  • MW: 13 kDa
  • Buffer composition: Tris-based buffer with 50% glycerol.
Description: Recombinant Mouse Insulin-1(Ins1) expressed in Yeast
Mouse Insulin-1 (Ins1)
  • EUR 611.00
  • EUR 309.00
  • EUR 1827.00
  • EUR 939.00
  • EUR 1218.00
  • EUR 397.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
  • MW: 14.5 kDa
  • Buffer composition: Tris-based buffer with 50% glycerol.
Description: Recombinant Mouse Insulin-1(Ins1) expressed in E.coli
C-Peptide Blocking Peptide
EUR 153
Recombinant (E. coli) purified Human Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB
IGFBP72-C 100 ul
EUR 286
Human Connecting Peptide (C-Peptide) Peptide
abx670072-05mg 0.5 mg
EUR 565
  • Shipped within 1 week.
E64I002 0.1mg
EUR 1675
E64I00201 0.1mg
EUR 424
RA18034 100 ul
EUR 483
RA20056 100 ul
EUR 370
Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit
DLR-IGF1-c-48T 48T
EUR 474
  • Should the Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Canine Insulin Like Growth Factor 1 (IGF1) in samples from serum, plasma or other biological fluids.
Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit
DLR-IGF1-c-96T 96T
EUR 614
  • Should the Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Canine Insulin Like Growth Factor 1 (IGF1) in samples from serum, plasma or other biological fluids.
Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit
RD-IGF1-c-48Tests 48 Tests
EUR 472
Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit
RD-IGF1-c-96Tests 96 Tests
EUR 653
Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit
RDR-IGF1-c-48Tests 48 Tests
EUR 493
Canine Insulin Like Growth Factor 1 (IGF1) ELISA Kit
RDR-IGF1-c-96Tests 96 Tests
EUR 683
Mouse C-Peptide (C-P) CLIA Kit
abx195459-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.
Mouse C-P(C-Peptide) ELISA Kit
STJ150015 1 kit
EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of C-P in Mouse serum, plasma and other biological fluids
ELISA kit for Mouse RXFP1 (Relaxin/Insulin Like Family Peptide Receptor 1)
E-EL-M1010 1 plate of 96 wells
EUR 534
  • Gentaur's RXFP1 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Mouse RXFP1. Standards or samples are added to the micro ELISA plate wells and combined with
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Mouse RXFP1 (Relaxin/Insulin Like Family Peptide Receptor 1) in samples from Serum, Plasma, Cell supernatant
Goat Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure
INSA21-A 100 ul
EUR 482
Monoclonal Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure
INSB22-M 100 ul
EUR 482
Recombinant (NS0) purified Mouse C-Reactive Protein (CRP) cotnrol for Western
CRP21-C 100 ul
EUR 286
Recombinant (NS0) purified Mouse C-Reactive Protein (CRP) cotnrol for Western
CRP24-C 100 ul
EUR 286
Human INSL4/ Early placenta insulin-like peptide ELISA Kit
E1323Hu 1 Kit
EUR 571
Human INSL4(Early placenta insulin-like peptide) ELISA Kit
EH1173 96T
EUR 567.6
  • Detection range: 0.312-20 ng/ml
  • Uniprot ID: Q14641
  • Alias: INSL4/EPIL(Early placenta insulin-like peptide)/Placentin/insulin-like 4(placenta)/Insulin-like peptide 4/Placentin
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml
Human Early placenta insulin- like peptide, INSL4 ELISA KIT
ELI-03359h 96 Tests
EUR 824
Rat IRAP (Insulin regulated aminopeptidase) Control/blocking peptide #1
IRAP11-P 100 ug
EUR 164
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
  • EUR 411.00
  • EUR 592.00
  • EUR 182.00
  • EUR 314.00
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul
  • Shipped within 5-10 working days.
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
  • EUR 314.00
  • EUR 98.00
  • EUR 398.00
  • EUR 495.00
  • 100 ug
  • 10 ug
  • 200 ug
  • 300 µg
  • Shipped within 5-10 working days.
Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody
abx122948-100ug 100 ug
EUR 391
  • Shipped within 5-10 working days.
Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.
Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.
Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide
  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.
Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody
  • EUR 411.00
  • EUR 133.00
  • EUR 1149.00
  • EUR 565.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody
  • EUR 411.00
  • EUR 133.00
  • EUR 1149.00
  • EUR 565.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody
abx030698-400ul 400 ul
EUR 523
  • Shipped within 5-10 working days.
Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody
abx030698-80l 80 µl
EUR 286
  • Shipped within 5-10 working days.
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
abx030791-400ul 400 ul
EUR 523
  • Shipped within 5-10 working days.
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
abx030791-80l 80 µl
EUR 286
  • Shipped within 5-10 working days.
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
  • EUR 857.00
  • EUR 439.00
  • 1 mg
  • 200 ug
  • Please enquire.
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
  • EUR 1205.00
  • EUR 578.00
  • 1 mg
  • 200 ug
  • Please enquire.
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
  • EUR 439.00
  • EUR 328.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
  • EUR 439.00
  • EUR 328.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
  • EUR 314.00
  • EUR 244.00
  • 100 ug
  • 50 ug
  • Shipped within 5-10 working days.
Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody
  • EUR 314.00
  • EUR 244.00
  • 100 ug
  • 50 ug
  • Shipped within 5-10 working days.
Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody
  • EUR 425.00
  • EUR 342.00
  • 100 ug
  • 50 ug
  • Shipped within 5-10 working days.
Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.
RR-SRC, Insulin Receptor Tyrosine Kinase Substrate (Biotin) Peptide
  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.
Insulin Like Growth Factor 1 (IGF1) (1-3) Peptide
  • EUR 328.00
  • EUR 495.00
  • EUR 272.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.
Insulin Like Growth Factor 1 (IGF1) (30-41) Peptide
  • EUR 495.00
  • EUR 815.00
  • EUR 356.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.
Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.
Human Early placenta insulin-like peptide(INSL4) ELISA kit
CSB-EL011748HU-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Early placenta insulin-like peptide (INSL4) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Human Early placenta insulin-like peptide(INSL4) ELISA kit
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Early placenta insulin-like peptide(INSL4) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)
KTE10416-48T 48T
EUR 354
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)
KTE10416-5platesof96wells 5 plates of 96 wells
EUR 2252
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)
KTE10416-96T 96T
EUR 572
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
ELISA kit for Human Insulin-like peptide INSL6 (INSL6)
KTE62243-48T 48T
EUR 354
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
ELISA kit for Human Insulin-like peptide INSL6 (INSL6)
KTE62243-5platesof96wells 5 plates of 96 wells
EUR 2252
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
ELISA kit for Human Insulin-like peptide INSL6 (INSL6)
KTE62243-96T 96T
EUR 572
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
Recombinant Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1)
  • EUR 530.08
  • EUR 245.00
  • EUR 1712.80
  • EUR 637.60
  • EUR 1175.20
  • EUR 418.00
  • EUR 4132.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Q9HBX9
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 18.9kDa
  • Isoelectric Point: 8.9
Description: Recombinant Human Relaxin/Insulin Like Family Peptide Receptor 1 expressed in: E.coli
Recombinant Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1)
  • EUR 504.99
  • EUR 238.00
  • EUR 1618.72
  • EUR 606.24
  • EUR 1112.48
  • EUR 401.00
  • EUR 3896.80
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Q9HBX9
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 19.2kDa
  • Isoelectric Point: 19.2kDa
Description: Recombinant Human Relaxin/Insulin Like Family Peptide Receptor 1 expressed in: E.coli
Rat C-Peptide/ C-Peptide ELISA Kit
E0225Ra 1 Kit
EUR 571
Human C-Peptide/ C-Peptide ELISA Kit
E0546Hu 1 Kit
EUR 537
Canine C Peptide(C Peptide) ELISA Kit
ECA0028 96T
EUR 567.6
  • Detection range: 0.781-50 ng/ml
  • Alias: C Peptide
Description: Method of detection: Coated with Antigen, Competitive ELISA;Reacts with: Canine;Sensitivity: 0.469 ng/ml
Chicken C-Peptide/ C-Peptide ELISA Kit
E0016Ch 1 Kit
EUR 717
Dog C-Peptide/ C-Peptide ELISA Kit
E0025Do 1 Kit
EUR 717
Pig C-Peptide/ C-Peptide ELISA Kit
E0044Pi 1 Kit
EUR 717
Human C-peptide(C-peptide) Elisa Kit
QY-E05491 96T
EUR 361
Rat Connecting Peptide (C-Peptide) Peptide (OVA)
  • EUR 425.00
  • EUR 230.00
  • EUR 1149.00
  • EUR 495.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Connecting Peptide (C-Peptide) Antibody
  • EUR 258.00
  • EUR 133.00
  • EUR 606.00
  • EUR 328.00
  • EUR 230.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Connecting Peptide (C-Peptide) Antibody
abx021134-100ug 100 ug
EUR 481
  • Shipped within 5-10 working days.
Connecting Peptide (C-Peptide) Antibody
abx021135-1mg 1 mg
EUR 739
  • Shipped within 5-10 working days.
Connecting Peptide (C-Peptide) Antibody
abx022864-01ml 0.1 ml
EUR 578
  • Shipped within 5-10 working days.
Connecting Peptide (C-peptide) Antibody
abx023812-1mg 1 mg
EUR 739
  • Shipped within 5-10 working days.
Connecting Peptide (C-Peptide) Antibody
abx411178-025mg 0.25 mg
EUR 565
  • Shipped within 1 week.
Connecting Peptide (C-Peptide) Antibody
abx414631-02mg 0.2 mg
EUR 565
  • Shipped within 1 week.
Connecting Peptide (C-Peptide) Antibody
abx414632-02mg 0.2 mg
EUR 565
  • Shipped within 1 week.
Connecting Peptide (C-Peptide) Antibody
abx414633-02mg 0.2 mg
EUR 565
  • Shipped within 1 week.
Connecting Peptide (C-Peptide) Antibody
abx414789-02mg 0.2 mg
EUR 565
  • Shipped within 1 week.
Connecting Peptide (C-Peptide) Antibody
abx414790-02mg 0.2 mg
EUR 565
  • Shipped within 1 week.
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone E2-E3 & 2D11-H5 (INS04 & INS05) (Concentrate)
RA0163-C.1 0.1 ml
EUR 125
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone E2-E3 & 2D11-H5 (INS04 & INS05) (Concentrate)
RA0163-C.5 0.5 ml
EUR 300
Mouse C-Peptide (CP) ELISA Kit
CEA447Mu-10x96wellstestplate 10x96-wells test plate
EUR 4391.16
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse C-Peptide (CP) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse C-Peptide (CP) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Mouse C-Peptide (CP) ELISA Kit
CEA447Mu-1x48wellstestplate 1x48-wells test plate
EUR 449.27
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse C-Peptide (CP) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse C-Peptide (CP) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Mouse C-Peptide (CP) ELISA Kit
CEA447Mu-1x96wellstestplate 1x96-wells test plate
EUR 598.96
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse C-Peptide (CP) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse C-Peptide (CP) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Mouse C-Peptide (CP) ELISA Kit
CEA447Mu-5x96wellstestplate 5x96-wells test plate
EUR 2395.32
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse C-Peptide (CP) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse C-Peptide (CP) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Mouse C-Peptide (CP) ELISA Kit
  • EUR 4442.00
  • EUR 2346.00
  • EUR 599.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as C-Peptide elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse C-Peptide (CP) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.
ELISA kit for Mouse C-Peptide
EK1778 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Mouse C-Peptide in samples from serum, plasma, tissue homogenates and other biological fluids.
Mouse C-Peptide (CP) CLIA Kit
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.
C-terminal Proghrelin Isoform Peptide, mouse
5-00888 4 x 5mg Ask for price
Mouse C-Peptide ELISA Kit (CP)
RK02705 96 Tests
EUR 521
C-terminal Proghrelin Isoform Peptide, mouse
SP-84141-5 5 mg
EUR 286
C-Peptide ELISA Kit (Mouse) (OKCD02261)
OKCD02261 96 Wells
EUR 779
Description: Description of target: Proinsulin C-peptide is the middle segment of proinsulin that is between the N-terminal B-chain and the C-terminal A-chain. It is a pancreatic peptide of about 31 residues, depending on the species. Upon proteolytic cleavage of proinsulin, equimolar INSULIN and C-peptide are released. C-peptide immunoassay has been used to assess pancreatic beta cell function in diabetic patients with circulating insulin antibodies or exogenous insulin. Half-life of C-peptide is 30 min, almost 8 times that of insulin.;Species reactivity: Mouse;Application: ;Assay info: Assay Methodology: Competitive Inhibition Immunoassay;Sensitivity: 37.35 pg/mL
C-Peptide ELISA Kit (Mouse) (OKEH00454)
OKEH00454 96 Wells
EUR 662
Description: Description of target: C-peptide is a protein that is produced in the body along with insulin. First preproinsulin is secreted with an A-chain, C-peptide, a B-chain, and a signal sequence. The signal sequence is cut off, leaving proinsulin. Then the C-peptide is cut off, leaving the A-chain and B-chain to form insulin.;Species reactivity: Mouse;Application: ;Assay info: Assay Methodology: Quantitative Competitive ELISA;Sensitivity: 0.083 ng/mL
Mouse Insulin (INS) ELISA Kit
CEA448Mu-10x96wellstestplate 10x96-wells test plate
EUR 4391.16
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Insulin (INS) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Insulin (INS) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Insulin C- peptide